RegulonDB RegulonDB 10.8: Gene Form
   

insH3 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lnt insH3 gltI sroC FlhDC FlhDC GcvB insHp6 insHp6 insHp5 insHp5 insHp3 insHp3 TSS_781 TSS_781 gltIp1 gltIp1 TSS_780 TSS_780 TSS_779 (cluster) TSS_779 (cluster) TSS_778 TSS_778

Gene      
Name: insH3    Texpresso search in the literature
Synonym(s): ECK0261, G6360, b0656, trs5-3, yi52_3
Genome position(nucleotides): 687997 <-- 688977 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.05
External database links:  
ASAP:
ABE-0002246
OU-MICROARRAY:
b0656
PortEco:
insH-3
STRING:
511145.b3505
COLOMBOS: insH3


Product      
Name: IS5 transposase and trans-activator
Synonym(s): InsH3
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.851
Isoelectric point: 10.028
Motif(s):
 
Type Positions Sequence
51 -> 124 GRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQLFKT
138 -> 312 QGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERPGKVRTLKQHPRKNKTAINIEYMKASIRARVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-4235
ECOLIWIKI:
b0656
INTERPRO:
IPR008490
INTERPRO:
IPR002559
PFAM:
PF01609
PFAM:
PF05598
PRIDE:
P0CE51
REFSEQ:
NP_415189
SMR:
P0CE51
UNIPROT:
P0CE51


Operon      
Name: insH3         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_778 687847 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_779 (cluster) 687855 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_780 687863 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_781 689004 reverse nd [RS-EPT-CBR] [1]
  promoter insHp3 689205 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter insHp5 689212 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter insHp6 689222 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB