RegulonDB RegulonDB 10.7: Gene Form
   

ybeX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lnt ybeX ybeY ybeZ TSS_782 TSS_782 lntp4 lntp4

Gene      
Name: ybeX    Texpresso search in the literature
Synonym(s): ECK0650, G6361, b0658
Genome position(nucleotides): 690906 <-- 691784 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.54
External database links:  
ASAP:
ABE-0002252
ECHOBASE:
EB3418
OU-MICROARRAY:
b0658
PORTECO:
ybeX
REGULONDB:
b0658
STRING:
511145.b0658
M3D: ybeX
COLOMBOS: ybeX
PortEco: b0658


Product      
Name: CorC-HlyC family protein YbeX
Synonym(s): YbeX
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 33.298
Isoelectric point: 4.304
Motif(s):
 
Type Positions Sequence
69 -> 124 VRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFPVISEDKDHIEGILMAKDLLP
73 -> 133 MIPRSQMITLKRNQTLDECLDVIIESAHSRFPVISEDKDHIEGILMAKDLLPFMRSDAEAF
135 -> 195 MDKVLRQAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGLVTIEDILELIVGEIEDE
141 -> 189 QAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGLVTIEDILELIV
206 -> 281 QLSRHTWTVRALASIEDFNEAFGTHFSDEEVDTIGGLVMQAFGHLPARGETIDIDGYQFKVAMADSRRIIQVHVKI

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005886 - plasma membrane
molecular_function GO:0050660 - flavin adenine dinucleotide binding
Note(s): Note(s): ...[more].
Reference(s): [1] Gibson MM., et al., 1991
External database links:  
DIP:
DIP-35960N
ECOCYC:
G6361-MONOMER
ECOLIWIKI:
b0658
INTERPRO:
IPR005170
INTERPRO:
IPR036318
INTERPRO:
IPR016169
INTERPRO:
IPR000644
MODBASE:
P0AE78
PDB:
5YZ2
PDB:
4HG0
PFAM:
PF03471
PFAM:
PF00571
PRIDE:
P0AE78
PRODB:
PRO_000022321
PROSITE:
PS51371
PROTEINMODELPORTAL:
P0AE78
REFSEQ:
NP_415191
SMART:
SM00116
SMART:
SM01091
SMR:
P0AE78
UNIPROT:
P0AE78


Operon      
Name: ybeZYX-lnt         
Operon arrangement:
Transcription unit        Promoter
ybeZYX-lnt
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter lntp4 690984 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_782 691877 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gibson MM., Bagga DA., Miller CG., Maguire ME., 1991, Magnesium transport in Salmonella typhimurium: the influence of new mutations conferring Co2+ resistance on the CorA Mg2+ transport system., Mol Microbiol 5(11):2753-62

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB