RegulonDB RegulonDB 10.7: Gene Form
   

ybeZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

miaB ybeZ ybeX ybeY anti-anti-terminator anti-terminator terminator ybeZp ybeZp TSS_784 TSS_784 TSS_783 TSS_783 TSS_782 TSS_782 lntp4 lntp4

Gene      
Name: ybeZ    Texpresso search in the literature
Synonym(s): ECK0652, G6363, b0660, phoL
Genome position(nucleotides): 692338 <-- 693378 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.37
External database links:  
ASAP:
ABE-0002257
ECHOBASE:
EB3420
OU-MICROARRAY:
b0660
PORTECO:
ybeZ
REGULONDB:
b0660
STRING:
511145.b0660
M3D: ybeZ
COLOMBOS: ybeZ
PortEco: b0660


Product      
Name: PhoH-like protein
Synonym(s): PhoL, YbeZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.039
Isoelectric point: 5.779
Motif(s):
 
Type Positions Sequence
142 -> 149 GPAGTGKT
118 -> 321 IKPRTPNQAQYIANILDHDITFGVGPAGTGKTYLAVAAAVDALERQEIRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGFEKVEKLIERNVIEVAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVITGDVTQIDLPRNTKSGLRHAIEVLADVEEISFNFFHSEDVVRHPVVARIVNAYE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47879N
ECOCYC:
G6363-MONOMER
ECOLIWIKI:
b0660
INTERPRO:
IPR003714
INTERPRO:
IPR027417
MINT:
MINT-1218508
PFAM:
PF02562
PRIDE:
P0A9K3
PROTEINMODELPORTAL:
P0A9K3
REFSEQ:
NP_415193
SMR:
P0A9K3
UNIPROT:
P0A9K3


Operon      
Name: ybeZYX-lnt         
Operon arrangement:
Transcription unit        Promoter
ybeZYX-lnt
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter lntp4 690984 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_782 691877 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_783 693429 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_784 693431 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB