RegulonDB RegulonDB 10.7: Gene Form
   

miaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

miaB ubiF ybeZ ybeY anti-anti-terminator anti-terminator terminator TSS_789 TSS_789 TSS_788 TSS_788 TSS_787 TSS_787 TSS_786 TSS_786 ybeZp ybeZp TSS_784 TSS_784 TSS_783 TSS_783

Gene      
Name: miaB    Texpresso search in the literature
Synonym(s): ECK0653, G6364, b0661, yleA
Genome position(nucleotides): 693531 <-- 694955 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.18
External database links:  
ASAP:
ABE-0002260
ECHOBASE:
EB3421
OU-MICROARRAY:
b0661
PORTECO:
miaB
REGULONDB:
b0661
STRING:
511145.b0661
M3D: miaB
COLOMBOS: miaB
PortEco: b0661


Product      
Name: isopentenyl-adenosine A37 tRNA methylthiolase
Synonym(s): MiaB, YleA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 53.663
Isoelectric point: 4.978
Motif(s):
 
Type Positions Sequence
4 -> 104 KLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFG
3 -> 120 KKLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLLLNTCSIREKAQEKVFHQLGRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFGPQTLHRLPEMINSVRG
161 -> 161 C
157 -> 157 C
151 -> 325 VSIMEGCNKYCTYCVVPYTRGEEVSRPSDDILFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLLRLVAAIDGIDRIRFTTSHPIEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTHTALEYKAIIRKLRAARPDIQISSDFIVGFPGETTEDFEKTMKLI

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0035596 - methylthiotransferase activity
GO:0035597 - N6-isopentenyladenosine methylthiotransferase activity
biological_process GO:0006400 - tRNA modification
GO:0030488 - tRNA methylation
GO:0008033 - tRNA processing
GO:0035600 - tRNA methylthiolation
Note(s): Note(s): ...[more].
Reference(s): [1] Hasnain G., et al., 2012
[2] Waller JC., et al., 2010
[3] Waller JC., et al., 2012
External database links:  
DIP:
DIP-48018N
ECOCYC:
G6364-MONOMER
ECOLIWIKI:
b0661
INTERPRO:
IPR005839
INTERPRO:
IPR023404
INTERPRO:
IPR002792
INTERPRO:
IPR038135
INTERPRO:
IPR006463
INTERPRO:
IPR006638
INTERPRO:
IPR007197
INTERPRO:
IPR013848
INTERPRO:
IPR020612
MINT:
MINT-1233637
MODBASE:
P0AEI1
PANTHER:
PTHR11918
PFAM:
PF01938
PFAM:
PF04055
PFAM:
PF00919
PRIDE:
P0AEI1
PRODB:
PRO_000023236
PROSITE:
PS50926
PROSITE:
PS51449
PROSITE:
PS01278
PROTEINMODELPORTAL:
P0AEI1
REFSEQ:
NP_415194
SMART:
SM00729
SMR:
P0AEI1
UNIPROT:
P0AEI1


Operon      
Name: miaB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_783 693429 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_784 693431 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_786 694991 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_787 695077 forward nd [RS-EPT-CBR] [4]
  promoter TSS_788 695184 forward nd [RS-EPT-CBR] [4]
  promoter TSS_789 695295 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hasnain G., Waller JC., Alvarez S., Ravilious GE., Jez JM., Hanson AD., 2012, Mutational analysis of YgfZ, a folate-dependent protein implicated in iron/sulphur cluster metabolism., FEMS Microbiol Lett 326(2):168-72

 [2] Waller JC., Alvarez S., Naponelli V., Lara-Nunez A., Blaby IK., Da Silva V., Ziemak MJ., Vickers TJ., Beverley SM., Edison AS., Rocca JR., Gregory JF., de Crecy-Lagard V., Hanson AD., 2010, A role for tetrahydrofolates in the metabolism of iron-sulfur clusters in all domains of life., Proc Natl Acad Sci U S A 107(23):10412-7

 [3] Waller JC., Ellens KW., Hasnain G., Alvarez S., Rocca JR., Hanson AD., 2012, Evidence that the Folate-Dependent Proteins YgfZ and MnmEG Have Opposing Effects on Growth and on Activity of the Iron-Sulfur Enzyme MiaB., J Bacteriol 194(2):362-7

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB