RegulonDB RegulonDB 10.8: Gene Form
   

ubiF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

miaB ubiF glnX anti-anti-terminator anti-terminator TSS_789 TSS_789 TSS_788 TSS_788 TSS_787 TSS_787 TSS_786 TSS_786

Gene      
Name: ubiF    Texpresso search in the literature
Synonym(s): ECK0654, G6365, b0662, yleB
Genome position(nucleotides): 695101 --> 696276 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.14
External database links:  
ASAP:
ABE-0002265
ECHOBASE:
EB3422
OU-MICROARRAY:
b0662
PortEco:
ubiF
STRING:
511145.b0662
COLOMBOS: ubiF


Product      
Name: 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase
Synonym(s): UbiF, YleB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.954
Isoelectric point: 7.161
Motif(s):
 
Type Positions Sequence
6 -> 338 TEIAIVGGGMVGGALALGLAQHGFAVTVIEHAEPAPFVADSQPDVRISAISAASVSLLKGLGVWDAVQAMRCHPYRRLETWEWETAHVVFDAAELKLPLLGYMVENTVLQQALWQALEAHPKVTLRVPGSLIALHRHDDLQELELKGGEVIRAKLVIGADGANSQVRQMAGIGVHAWQYAQSCMLISVQCENDPGDSTWQQFTPDGPRAFLPLFDNWASLVWYDSPARIRQLQNMNMAQLQAEIAKHFPSRLGYVTPLAAGAFPLTRRHALQYVQPGLALVGDAAHTIHPLAGQGVNLGYRDVDALIDVLVNARSYGEAWASYPVLKRYQMRR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0110142 - ubiquinone biosynthesis complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0004497 - monooxygenase activity
GO:0016705 - oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0050660 - flavin adenine dinucleotide binding
GO:0016709 - oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0008682 - 2-octoprenyl-3-methyl-6-methoxy-1,4-benzoquinone hydroxylase activity
GO:0071949 - FAD binding
biological_process GO:0006744 - ubiquinone biosynthetic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Adachi A., et al., 2003
[2] Alexander K., et al., 1978
[3] Tran UC., et al., 2006
External database links:  
DIP:
DIP-11069N
ECOCYC:
OCTAPRENYL-METHYL-METHOXY-BENZOQ-OH-MON
ECOLIWIKI:
b0662
INTERPRO:
IPR018168
INTERPRO:
IPR036188
INTERPRO:
IPR010971
INTERPRO:
IPR002938
MODBASE:
P75728
PFAM:
PF01494
PRIDE:
P75728
PRINTS:
PR00420
PRODB:
PRO_000024158
PROSITE:
PS01304
REFSEQ:
NP_415195
SMR:
P75728
UNIPROT:
P75728


Operon      
Name: ubiF         
Operon arrangement:
Transcription unit        Promoter
ubiF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_786 694991 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_787 695077 forward nd [RS-EPT-CBR] [4]
  promoter TSS_788 695184 forward nd [RS-EPT-CBR] [4]
  promoter TSS_789 695295 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Adachi A., Shinjyo N., Fujita D., Miyoshi H., Amino H., Watanabe Yi., Kita K., 2003, Complementation of Escherichia coli ubiF mutation by Caenorhabditis elegans CLK-1, a product of the longevity gene of the nematode worm., FEBS Lett 543(1-3):174-8

 [2] Alexander K., Young IG., 1978, Alternative hydroxylases for the aerobic and anaerobic biosynthesis of ubiquinone in Escherichia coli., Biochemistry 17(22):4750-5

 [3] Tran UC., Marbois B., Gin P., Gulmezian M., Jonassen T., Clarke CF., 2006, Complementation of Saccharomyces cerevisiae coq7 mutants by mitochondrial targeting of the Escherichia coli UbiF polypeptide: two functions of yeast Coq7 polypeptide in coenzyme Q biosynthesis., J Biol Chem 281(24):16401-9

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB