RegulonDB RegulonDB 10.7: Gene Form
   

zitB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nadA zitB pnuC ybgS zitBp2 zitBp2 zitBp1 zitBp1 TSS_913 TSS_913 TSS_912 TSS_912 TSS_911 TSS_911 TSS_910 TSS_910 TSS_909 TSS_909 TSS_908 TSS_908 TSS_907 TSS_907 TSS_906 (cluster) TSS_906 (cluster) TSS_905 TSS_905 TSS_904 (cluster) TSS_904 (cluster) TSS_903 (cluster) TSS_903 (cluster) TSS_902 TSS_902

Gene      
Name: zitB    Texpresso search in the literature
Synonym(s): ECK0741, G6393, b0752, ybgR
Genome position(nucleotides): 783882 <-- 784823 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.08
External database links:  
ASAP:
ABE-0002549
ECHOBASE:
EB3426
MIM:
125853
OU-MICROARRAY:
b0752
PORTECO:
zitB
REGULONDB:
b0752
STRING:
511145.b0752
M3D: zitB
COLOMBOS: zitB
PortEco: b0752


Product      
Name: Zn2+/Cd2+/Ni2+/Cu2+ exporter
Synonym(s): YbgR, ZitB, ZitB zinc CDF transporter
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 34.678
Isoelectric point: 6.825
Motif(s):
 
Type Positions Sequence
21 -> 41 LLYAFGVTAGFMLVEVVGGFL
90 -> 110 AAFVNAIALVVITILIVWEAI
22 -> 213 LYAFGVTAGFMLVEVVGGFLSGSLALLADAGHMLTDTAALLFALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITILIVWEAIERFRTPRPVEGGMMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGDLLGSVGAIIAALIIIWTGWTPADPILSILVSLLVLRSAWRLLKDSVNELL
122 -> 142 GMMMAIAVAGLLANILSFWLL
160 -> 180 VLGDLLGSVGAIIAALIIIWT

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0008324 - cation transmembrane transporter activity
GO:0005385 - zinc ion transmembrane transporter activity
biological_process GO:0006811 - ion transport
GO:0006812 - cation transport
GO:0006829 - zinc ion transport
GO:0055085 - transmembrane transport
GO:0071577 - zinc ion transmembrane transport
GO:0098655 - cation transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
B0752-MONOMER
ECOLIWIKI:
b0752
INTERPRO:
IPR036837
INTERPRO:
IPR027469
INTERPRO:
IPR023500
INTERPRO:
IPR002524
PANTHER:
PTHR11562
PFAM:
PF01545
PRIDE:
P75757
PRODB:
PRO_000024248
PROTEINMODELPORTAL:
P75757
REFSEQ:
NP_415273
SMR:
P75757
UNIPROT:
P75757


Operon      
Name: zitB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_902 782098 forward nd [RS-EPT-CBR] [1]
  promoter TSS_903 (cluster) 782352 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_904 (cluster) 782372 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_905 782376 forward nd [RS-EPT-CBR] [1]
  promoter TSS_906 (cluster) 782394 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_907 782424 forward nd [RS-EPT-CBR] [1]
  promoter TSS_908 783540 forward nd [RS-EPT-CBR] [1]
  promoter TSS_909 783611 forward nd [RS-EPT-CBR] [1]
  promoter TSS_910 783630 forward nd [RS-EPT-CBR] [1]
  promoter TSS_911 784191 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_912 784253 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_913 784403 reverse nd [RS-EPT-CBR] [1]
  promoter zitBp1 784848 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter zitBp2 784858 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB