RegulonDB RegulonDB 10.7: Gene Form
   

ybgS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aroG zitB ybgS pnuC CpxR TyrR TSS_926 TSS_926 TSS_925 (cluster) TSS_925 (cluster) TSS_924 (cluster) TSS_924 (cluster) TSS_923 TSS_923 TSS_922 TSS_922 TSS_921 (cluster) TSS_921 (cluster) TSS_920 (cluster) TSS_920 (cluster) TSS_919 TSS_919 TSS_918 (cluster) TSS_918 (cluster) TSS_917 (cluster) TSS_917 (cluster) aroGp aroGp ybgSp8 ybgSp8 ybgSp7 ybgSp7 TSS_915 TSS_915 ybgSp2 ybgSp2 TSS_914 TSS_914 ybgSp5 ybgSp5 ybgSp1 ybgSp1 zitBp2 zitBp2 zitBp1 zitBp1 TSS_913 TSS_913 TSS_912 TSS_912 TSS_911 TSS_911

Gene      
Name: ybgS    Texpresso search in the literature
Synonym(s): ECK0742, G6394, b0753
Genome position(nucleotides): 784937 <-- 785317 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.39
External database links:  
ASAP:
ABE-0002553
ECHOBASE:
EB3427
OU-MICROARRAY:
b0753
PORTECO:
ybgS
REGULONDB:
b0753
STRING:
511145.b0753
M3D: ybgS
COLOMBOS: ybgS
PortEco: b0753


Product      
Name: PF13985 family protein YbgS
Synonym(s): YbgS
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 12.872
Isoelectric point: 4.431
Motif(s):
 
Type Positions Sequence
1 -> 24 MKMTKLATLFLTATLSLASGAALA
3 -> 126 MTKLATLFLTATLSLASGAALAADSGAQTNNGQANAAADAGQVAPDARENVAPNNVDNNGVNTGSGGTMLHSDGSSMNNDGMTKDEEHKNTMCKDGRCPDINKKVQTGDGINNDVDTKTDGTTQ
25 -> 126 ADSGAQTNNGQANAAADAGQVAPDARENVAPNNVDNNGVNTGSGGTMLHSDGSSMNNDGMTKDEEHKNTMCKDGRCPDINKKVQTGDGINNDVDTKTDGTTQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Fagerquist CK., et al., 2010
[2] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
G6394-MONOMER
ECOLIWIKI:
b0753
INTERPRO:
IPR020363
PFAM:
PF13985
PRIDE:
P0AAV6
PRODOM:
PD079292
PROTEINMODELPORTAL:
P0AAV6
REFSEQ:
NP_415274
UNIPROT:
P0AAV6


Operon      
Name: ybgS         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_911 784191 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_912 784253 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_913 784403 reverse nd [RS-EPT-CBR] [3]
  promoter zitBp1 784848 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter zitBp2 784858 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ybgSp1 785339 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ybgSp5 785373 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_914 785390 reverse nd [RS-EPT-CBR] [3]
  promoter ybgSp2 785459 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_915 785462 reverse nd [RS-EPT-CBR] [3]
  promoter ybgSp7 785465 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ybgSp8 785496 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_917 (cluster) 785597 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_918 (cluster) 785602 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_919 785605 forward nd [RS-EPT-CBR] [3]
  promoter TSS_920 (cluster) 785607 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_921 (cluster) 785612 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_922 785622 forward nd [RS-EPT-CBR] [3]
  promoter TSS_923 785768 forward nd [RS-EPT-CBR] [3]
  promoter TSS_924 (cluster) 785886 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_925 (cluster) 785890 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_926 785897 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Fagerquist CK., Garbus BR., Williams KE., Bates AH., Harden LA., 2010, Covalent attachment and dissociative loss of sinapinic acid to/from cysteine-containing proteins from bacterial cell lysates analyzed by MALDI-TOF-TOF mass spectrometry., J Am Soc Mass Spectrom 21(5):819-32

 [2] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB