RegulonDB RegulonDB 10.8: Gene Form
   

ybhJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybhJ ybhI ybhC terminator

Gene      
Name: ybhJ    Texpresso search in the literature
Synonym(s): ECK0760, G6401, b0771
Genome position(nucleotides): 803503 --> 805764 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.46
External database links:  
ASAP:
ABE-0002626
ECHOBASE:
EB3430
OU-MICROARRAY:
b0771
PortEco:
ybhJ
STRING:
511145.b0771
COLOMBOS: ybhJ


Product      
Name: putative hydratase YbhJ
Synonym(s): YbhJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 81.504
Isoelectric point: 5.321
Motif(s):
 
Type Positions Sequence
41 -> 470 ILSSHNTSGNMDKLKIKFDSLASHDITFVGIVQTAKASGMERFPLPYVLTNCHNSLCAVGGTINGDDHVFGLSAAQRYGGIFVPPHIAVIHQYMREMMAGGGKMILGSDSHTRYGALGTMAVGEGGGELVKQLLNDTWDIDYPGVVAVHLTGKPAPYVGPQDVALAIIGAVFKNGYVKNKVMEFVGPGVSALSTDFRNSVDVMTTETTCLSSVWQTDEEVHNWLALHGRGQDYCQLNPQPMAYYDGCISVDLSAIKPMIALPFHPSNVYEIDTLNQNLTDILREIEIESERVAHGKAKLSLLDKVENGRLKVQQGIIAGCSGGNYENVIAAANALRGQSCGNDTFSLAVYPSSQPVFMDLAKKGVVADLIGAGAIIRTAFCGPCFGAGDTPINNGLSIRHTTRNFPNREGSKPANGQMSAVALMDARSIA
636 -> 684 KPGDGSAREQAASCQRVIGGLANIAEEYATKRYRSNVINWGMLPLQMAE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0003994 - aconitate hydratase activity
biological_process GO:0006099 - tricarboxylic acid cycle
GO:0006979 - response to oxidative stress
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11413N
ECOCYC:
G6401-MONOMER
ECOLIWIKI:
b0771
INTERPRO:
IPR001030
INTERPRO:
IPR036008
INTERPRO:
IPR015932
INTERPRO:
IPR015931
INTERPRO:
IPR000573
MODBASE:
P75764
PANTHER:
PTHR11670
PFAM:
PF00330
PFAM:
PF00694
PRIDE:
P75764
PRINTS:
PR00415
PROSITE:
PS01244
PROSITE:
PS00450
REFSEQ:
NP_415292
SMR:
P75764
UNIPROT:
P75764


Operon      
Name: ybhJ         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB