RegulonDB RegulonDB 10.8: Gene Form
   

clsB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

clsB ybhN ybhP ybhM ybhQ ybhR ybhQp ybhQp ybhNp5 ybhNp5

Gene      
Name: clsB    Texpresso search in the literature
Synonym(s): ECK0778, G6406, b0789, ybhO
Genome position(nucleotides): 822498 <-- 823739 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.43
External database links:  
ASAP:
ABE-0002692
ECHOBASE:
EB3435
OU-MICROARRAY:
b0789
PortEco:
ybhO
STRING:
511145.b0789
COLOMBOS: clsB


Product      
Name: cardiolipin synthase B
Synonym(s): ClsB, YbhO, cardiolipin synthase 2
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 47.634
Isoelectric point: 8.595
Motif(s):
 
Type Positions Sequence
26 -> 142 KAIGEAQERIILETFIWFEDDVGKQLHAALLAAAQRGVKAEVLLDGYGSPDLSDEFVNELTAAGVVFRYYDPRPRLFGMRTNVFRRMHRKIVVIDARIAFIGGLNYSAEHMSSYGPE
108 -> 135 VFRRMHRKIVVIDARIAFIGGLNYSAEH
285 -> 312 RRRPLHGKVALMDDHWATVGSSNLDPLS
214 -> 336 KMLTQARREVIIANAYFFPGYRFLHALRKAARRGVRIKLIIQGEPDMPIVRVGARLLYNYLVKGGVQVFEYRRRPLHGKVALMDDHWATVGSSNLDPLSLSLNLEANVIIHDRHFNQTLRDNL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.1 - phospholipid
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016780 - phosphotransferase activity, for other substituted phosphate groups
GO:0004630 - phospholipase D activity
GO:0008808 - cardiolipin synthase activity
biological_process GO:0006629 - lipid metabolic process
GO:0008654 - phospholipid biosynthetic process
GO:0032049 - cardiolipin biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6406-MONOMER
ECOLIWIKI:
b0789
INTERPRO:
IPR025202
INTERPRO:
IPR001736
INTERPRO:
IPR030872
MODBASE:
P0AA84
PANTHER:
PTHR21248:SF1
PFAM:
PF13091
PRIDE:
P0AA84
PROSITE:
PS50035
REFSEQ:
NP_415310
SMART:
SM00155
SMR:
P0AA84
UNIPROT:
P0AA84


Operon      
Name: ybhP-clsB-ybhN         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybhNp5 822648 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB