RegulonDB RegulonDB 10.6.3: Gene Form
   

ybhF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybhF ybhS ybhR ybhG cecR ybhQ TSS_957 TSS_957 TSS_956 TSS_956 TSS_955 TSS_955 TSS_954 TSS_954 TSS_953 TSS_953

Gene      
Name: ybhF    Texpresso search in the literature
Synonym(s): ECK0783, G6411, b0794
Genome position(nucleotides): 827245 <-- 828981 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.56
External database links:  
ASAP:
ABE-0002707
ECHOBASE:
EB3098
ECOCYC:
G6411
ECOLIHUB:
ybhF
OU-MICROARRAY:
b0794
REGULONDB:
b0794
STRING:
511145.b0794
M3D: ybhF
COLOMBOS: ybhF
PortEco: b0794


Product      
Name: putative ABC exporter ATP binding subunit
Synonym(s): YbhF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 63.132
Isoelectric point: 5.397
Motif(s):
 
Type Positions Sequence
362 -> 369 GPNGAGKS
40 -> 47 GPDGAGKT
330 -> 559 IEAKELTKKFGDFAATDHVNFAVKRGEIFGLLGPNGAGKSTTFKMMCGLLVPTSGQALVLGMDLKESSGKARQHLGYMAQKFSLYGNLTVEQNLRFFSGVYGLRGRAQNEKISRMSEAFGLKSIASHATDELPLGFKQRLALACSLMHEPDILFLDEPTSGVDPLTRREFWLHINSMVEKGVTVMVTTHFMDEAEYCDRIGLVYRGKLIASGTPDDLKAQSANDEQPDPT
6 -> 237 ITLNGLEKRFPGMDKPAVAPLDCTIHAGYVTGLVGPDGAGKTTLMRMLAGLLKPDSGSATVIGFDPIKNDGALHAVLGYMPQKFGLYEDLTVMENLNLYADLRSVTGEARKQTFARLLEFTSLGPFTGRLAGKLSGGMKQKLGLACTLVGEPKVLLLDEPGVGVDPISRRELWQMVHELAGEGMLILWSTSYLDEAEQCRDVLLMNEGELLYQGEPKALTQTMAGRSFLMTS
26 -> 165 LDCTIHAGYVTGLVGPDGAGKTTLMRMLAGLLKPDSGSATVIGFDPIKNDGALHAVLGYMPQKFGLYEDLTVMENLNLYADLRSVTGEARKQTFARLLEFTSLGPFTGRLAGKLSGGMKQKLGLACTLVGEPKVLLLDEP

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015562 - efflux transmembrane transporter activity
biological_process GO:1990961 - drug transmembrane export
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48149N
ECOCYC:
YBHF-MONOMER
ECOLIWIKI:
b0794
INTERPRO:
IPR003439
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003593
MINT:
MINT-1249856
MODBASE:
P0A9U1
PFAM:
PF00005
PRIDE:
P0A9U1
PROSITE:
PS00211
PROSITE:
PS50893
PROTEINMODELPORTAL:
P0A9U1
REFSEQ:
NP_415315
SMART:
SM00382
SMR:
P0A9U1
UNIPROT:
P0A9U1


Operon      
Name: cecR-ybhGFSR         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Repressed by: CecR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_953 829107 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_954 829469 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_955 829473 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_956 830082 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_957 830088 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB