RegulonDB RegulonDB 10.6.3: Gene Form
   

ybhG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybhF rhlE ybhS ybhG cecR CecR TSS_959 TSS_959 rhlEp5 rhlEp5 TSS_958 TSS_958 cecRp cecRp TSS_957 TSS_957 TSS_956 TSS_956 TSS_955 TSS_955 TSS_954 TSS_954 TSS_953 TSS_953

Gene      
Name: ybhG    Texpresso search in the literature
Synonym(s): ECK0784, G6412, b0795
Genome position(nucleotides): 828974 <-- 829972 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.06
External database links:  
ASAP:
ABE-0002709
ECHOBASE:
EB3099
ECOCYC:
G6412
ECOLIHUB:
ybhG
OU-MICROARRAY:
b0795
REGULONDB:
b0795
STRING:
511145.b0795
M3D: ybhG
COLOMBOS: ybhG
PortEco: b0795


Product      
Name: HlyD_D23 family protein YbhG
Synonym(s): YbhG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 36.416
Isoelectric point: 5.245
Motif(s):
 
Type Positions Sequence
1 -> 20 MMKKPVVIGLAVVVLAAVVA
43 -> 319 RTVNLSFRVGGRVESLAVDEGDAIKAGQVLGELDHKPYEIALMQAKAGVSVAQAQYDLMLAGYRNEEIAQAAAAVKQAQAAYDYAQNFYNRQQGLWKSRTISANDLENARSSRDQAQATLKSAQDKLRQYRSGNREQDIAQAKASLEQAQAQLAQAELNLQDSTLIAPSDGTLLTRAVEPGTVLNEGGTVFTVSLTRPVWVRAYVDERNLDQAQPGRKVLLYTDGRPDKPYHGQIGFVSPTAEFTPKTVETPDLRTDLVYRLRIVVTDADDALRQGM
21 -> 332 GGYWWYQSRQDNGLTLYGNVDIRTVNLSFRVGGRVESLAVDEGDAIKAGQVLGELDHKPYEIALMQAKAGVSVAQAQYDLMLAGYRNEEIAQAAAAVKQAQAAYDYAQNFYNRQQGLWKSRTISANDLENARSSRDQAQATLKSAQDKLRQYRSGNREQDIAQAKASLEQAQAQLAQAELNLQDSTLIAPSDGTLLTRAVEPGTVLNEGGTVFTVSLTRPVWVRAYVDERNLDQAQPGRKVLLYTDGRPDKPYHGQIGFVSPTAEFTPKTVETPDLRTDLVYRLRIVVTDADDALRQGMPVTVQFGDEAGHE

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport
Gene Ontology Terms (GO)  
cellular_component GO:0042597 - periplasmic space
GO:0005886 - plasma membrane
biological_process GO:0006810 - transport
GO:0046677 - response to antibiotic
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6412-MONOMER
ECOLIWIKI:
b0795
INTERPRO:
IPR022936
INTERPRO:
IPR032317
MODBASE:
P75777
PFAM:
PF16576
PRIDE:
P75777
PROTEINMODELPORTAL:
P75777
REFSEQ:
NP_415316
SMR:
P75777
UNIPROT:
P75777


Operon      
Name: cecR-ybhGFSR         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Repressed by: CecR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_953 829107 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_954 829469 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_955 829473 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_956 830082 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_957 830088 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_958 830670 reverse nd [RS-EPT-CBR] [1]
  promoter rhlEp5 830783 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_959 830785 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB