RegulonDB RegulonDB 10.8: Gene Form
   

rlmF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybiO rlmF glnQ mcbA glnP CRP TSS_963 TSS_963 ybiOp5 ybiOp5 ybiOp2 ybiOp2 rlmFp7 rlmFp7 rlmFp1 rlmFp1 mcbAp5 mcbAp5

Gene      
Name: rlmF    Texpresso search in the literature
Synonym(s): ECK0796, G6416, b0807, ybiN
Genome position(nucleotides): 842332 --> 843258 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.15
External database links:  
ASAP:
ABE-0002757
ECHOBASE:
EB3103
OU-MICROARRAY:
b0807
PortEco:
rlmF
STRING:
511145.b0807
COLOMBOS: rlmF


Product      
Name: 23S rRNA m6A1618 methyltransferase
Synonym(s): RlmF, YbiN, ribosomal RNA large subunit methyltransferase F
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.226
Isoelectric point: 9.575
Motif(s):
 
Type Positions Sequence
3 -> 296 AQKPGLHPRNRHHSRYDLATLCQVNPELRQFLTLTPAGEQSVDFANPLAVKALNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAEASGTIPANASILDIGVGANCIYPLIGVHEYGWRFTGSETSSQALSSAQAIISSNPGLNRAIRLRRQKESGAIFNGIIHKNEQYDATLCNPPFHDSAAAARAGSERKRRNLGLNKDDALNFGGQQQELWCEGGEVTFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQKQSRFIAWTFMN

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0008988 - rRNA (adenine-N6-)-methyltransferase activity
GO:0052907 - 23S rRNA (adenine(1618)-N(6))-methyltransferase activity
biological_process GO:0006364 - rRNA processing
GO:0032259 - methylation
GO:0070475 - rRNA base methylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11434N
ECOCYC:
G6416-MONOMER
ECOLIWIKI:
b0807
INTERPRO:
IPR029063
INTERPRO:
IPR016909
INTERPRO:
IPR010286
MINT:
MINT-1267834
PANTHER:
PTHR13393
PFAM:
PF05971
PRIDE:
P75782
PRODB:
PRO_000023768
REFSEQ:
NP_415328
SMR:
P75782
UNIPROT:
P75782


Operon      
Name: rlmF         
Operon arrangement:
Transcription unit        Promoter
ybiN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rlmFp1 842192 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter rlmFp7 842224 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybiOp2 845509 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybiOp5 845664 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_963 845736 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB