RegulonDB RegulonDB 10.7: Gene Form
   

opgE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

opgE ompX rybA yliL mntS MntR MicA rybAp rybAp TSS_978 TSS_978 ybiPp5 ybiPp5

Gene      
Name: opgE    Texpresso search in the literature
Synonym(s): ECK0804, G6418, b0815, ybiP
Genome position(nucleotides): 851014 <-- 852597 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.36
External database links:  
ASAP:
ABE-0002786
ECHOBASE:
EB3105
OU-MICROARRAY:
b0815
PORTECO:
ybiP
REGULONDB:
b0815
STRING:
511145.b0815
M3D: opgE
COLOMBOS: opgE
PortEco: b0815


Product      
Name: phosphoethanolamine transferase
Synonym(s): OpgE, YbiP
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 59.706
Isoelectric point: 8.682
Motif(s):
 
Type Positions Sequence
34 -> 54 LGYPFSLLYTAAFTAILLLLW
107 -> 127 IFPWYSYLVGLFIFALGVIAI
63 -> 83 VLVGVSSLVAACYFPFAQAYG
217 -> 483 QTYVVVIGESARRDALGAFGGHWDNTPFASSVNGLIFADYIAASGSTQKSLGLTLNRVVDGKPQFQDNFVTLANRAGFQTWWFSNQGQIGEYDTAIASIAKRADEVYFLKEGNFEADKNTKDEALLDMTAQVLAQEHSQPQLIVLHLMGSHPQACDRTQGKYETFVQSKETSCYLYTMTQTDDLLRKLYDQLRNSGSSFSLVYFSDHGLAFKERGKDVQYLAHDDKYQQNFQVPFMVISSDDKAHRVIKARRSANDFLGFFSQWTGI
147 -> 167 VFSVATFFVAPVQNLAWGGVF

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016776 - phosphotransferase activity, phosphate group as acceptor
GO:0008484 - sulfuric ester hydrolase activity
biological_process GO:0009244 - lipopolysaccharide core region biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6418-MONOMER
ECOLIWIKI:
b0815
INTERPRO:
IPR000917
INTERPRO:
IPR017850
INTERPRO:
IPR040423
MODBASE:
P75785
PANTHER:
PTHR30443
PFAM:
PF00884
PRIDE:
P75785
PROTEINMODELPORTAL:
P75785
REFSEQ:
NP_415336
SMR:
P75785
UNIPROT:
P75785


Operon      
Name: opgE         
Operon arrangement:
Transcription unit        Promoter
ybiP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybiPp5 852626 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_978 853047 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB