RegulonDB RegulonDB 10.6.3: Gene Form
   

mntR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybiR ldtB mntR rybA mntS yliL MntR MntR TSS_980 TSS_980 TSS_979 TSS_979 mntRp4 mntRp4 mntRp mntRp mntRp5 mntRp5 mntRp6 mntRp6 rybAp rybAp TSS_978 TSS_978

Gene      
Name: mntR    Texpresso search in the literature
Synonym(s): ECK0807, G6420, b0817, ybiQ
Genome position(nucleotides): 853183 --> 853650 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.06
External database links:  
ASAP:
ABE-0002793
ECHOBASE:
EB3106
ECOCYC:
G6420
ECOLIHUB:
mntR
OU-MICROARRAY:
b0817
REGULONDB:
b0817
STRING:
511145.b0817
M3D: mntR
COLOMBOS: mntR
PortEco: b0817


Product      
Name: DNA-binding transcriptional dual regulator MntR
Synonym(s): MntR, YbiQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.64
Isoelectric point: 6.81
Motif(s):
 
Type Positions Sequence
38 -> 92 IDDYVELISDLIREVGEARQVDMAARLGVSQPTVAKMLKRLATMGLIEMIPWRGV
95 -> 149 TAEGEKLAQESRERHQIVENFLLVLGVSPEIARRDAEGMEHHVSEETLDAFRLFT
34 -> 95 RRELIDDYVELISDLIREVGEARQVDMAARLGVSQPTVAKMLKRLATMGLIEMIPWRGVFLT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0046914 - transition metal ion binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0030145 - manganese ion binding
GO:0046983 - protein dimerization activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:2000144 - positive regulation of DNA-templated transcription, initiation
External database links:  
DIP:
DIP-28083N
ECOCYC:
G6420-MONOMER
ECOLIWIKI:
b0817
INTERPRO:
IPR036388
INTERPRO:
IPR036421
INTERPRO:
IPR036390
INTERPRO:
IPR022689
INTERPRO:
IPR022687
INTERPRO:
IPR001367
MODBASE:
P0A9F1
PDB:
2H09
PFAM:
PF01325
PFAM:
PF02742
PRIDE:
P0A9F1
PRODB:
PRO_000023259
PROSITE:
PS50944
PROTEINMODELPORTAL:
P0A9F1
REFSEQ:
NP_415338
SMART:
SM00529
SMR:
P0A9F1
UNIPROT:
P0A9F1


Operon      
Name: mntR-ybiR         
Operon arrangement:
Transcription unit        Promoter
null


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_978 853047 reverse nd [RS-EPT-CBR] [1]
  promoter mntRp6 853080 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter mntRp5 853083 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter mntRp4 853135 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_979 853137 forward nd [RS-EPT-CBR] [1]
  promoter TSS_980 855304 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB