RegulonDB RegulonDB 10.7: Gene Form
   

ybiT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybiT ybiU ldtB CRP AscG ybiTp ybiTp ldtBp ldtBp TSS_980 TSS_980

Gene      
Name: ybiT    Texpresso search in the literature
Synonym(s): ECK0810, G6423, b0820
Genome position(nucleotides): 855963 --> 857555 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.79
External database links:  
ASAP:
ABE-0002801
ECHOBASE:
EB3109
OU-MICROARRAY:
b0820
PORTECO:
ybiT
REGULONDB:
b0820
STRING:
511145.b0820
M3D: ybiT
COLOMBOS: ybiT
PortEco: b0820


Product      
Name: putative ATP-binding protein YbiT
Synonym(s): YbiT
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 59.858
Isoelectric point: 4.711
Motif(s):
 
Type Positions Sequence
336 -> 467 KNLNLLLEVGEKLAVLGTNGVGKSTLLKTLVGDLQPDSGTVKWSENARIGYYAQDHEYEFENDLTVFEWMSQWKQEGDDEQAVRSILGRLLFSQDDIKKPAKVLSGGEKGRMLFGKLMMQKPNILIMDEPTN
34 -> 41 GANGSGKS
224 -> 309 DLDYGELRVYPGNYDEYMTAATQARERLLADNAKKKAQIAELQSFVSRFSANASKSRQATSRARQIDKIKLEEVKASSRQNPFIRF
352 -> 359 GTNGVGKS
2 -> 252 LVSSNVTMQFGSKPLFENISVKFGGGNRYGLIGANGSGKSTFMKILGGDLEPTLGNVSLDPNERIGKLRQDQFAFEEFTVLDTVIMGHKELWEVKQERDRIYALPEMSEEDGYKVADLEVKYGEMDGYSAEARAGELLLGVGIPVEQHYGPMSEVAPGWKLRVLLAQALFADPDILLLDEPTNNLDIDTIRWLEQVLNERDSTMIIISHDRHFLNMVCTHMADLDYGELRVYPGNYDEYMTAATQARERLL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Llama-Palacios A., et al., 2002
[2] Phadtare S., et al., 2004
[3] Xu Y., et al., 2017
External database links:  
DIP:
DIP-11439N
ECOCYC:
G6423-MONOMER
ECOLIWIKI:
b0820
INTERPRO:
IPR003593
INTERPRO:
IPR003439
INTERPRO:
IPR027417
INTERPRO:
IPR032781
MINT:
MINT-1321005
MODBASE:
P0A9U3
PFAM:
PF12848
PFAM:
PF00005
PRIDE:
P0A9U3
PROSITE:
PS50893
PROTEINMODELPORTAL:
P0A9U3
REFSEQ:
NP_415341
SMART:
SM00382
SMR:
P0A9U3
UNIPROT:
P0A9U3


Operon      
Name: ybiT         
Operon arrangement:
Transcription unit        Promoter
ybiT


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP, AscG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_980 855304 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Llama-Palacios A., Lopez-Solanilla E., Rodriguez-Palenzuela P., 2002, The ybiT gene of Erwinia chrysanthemi codes for a putative ABC transporter and is involved in competitiveness against endophytic bacteria during infection., Appl Environ Microbiol 68(4):1624-30

 [2] Phadtare S., Inouye M., 2004, Genome-wide transcriptional analysis of the cold shock response in wild-type and cold-sensitive, quadruple-csp-deletion strains of Escherichia coli., J Bacteriol 186(20):7007-14

 [3] Xu Y., Liu Y., Li F., Cao G., Zheng P., Sun J., Wen J., Zhang D., 2017, Identification of a new gene yecC involved in threonine export in Escherichia coli., FEMS Microbiol Lett 364(17)

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB