RegulonDB RegulonDB 10.7: Gene Form
   

ybiV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybiW ybiU ybiV ybiVp5 ybiVp5 ybiUp6 ybiUp6 ybiUp7 ybiUp7 ybiUp5 ybiUp5

Gene      
Name: ybiV    Texpresso search in the literature
Synonym(s): ECK0812, G6425, b0822, supH
Genome position(nucleotides): 859213 <-- 860028 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.69
External database links:  
ASAP:
ABE-0002807
ECHOBASE:
EB3111
OU-MICROARRAY:
b0822
PORTECO:
ybiV
REGULONDB:
b0822
STRING:
511145.b0822
M3D: ybiV
COLOMBOS: ybiV
PortEco: b0822


Product      
Name: sugar phosphatase YbiV
Synonym(s): HAD12, SupH, YbiV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.413
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
6 -> 259 IVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPELKDEISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKDKQLNFVACGLQSAYVSENAPEAFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQIPLVIDKLHVALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATDDNNHEGALNVI
44 -> 45 SG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0050286 - sorbitol-6-phosphatase activity
GO:0103026 - fructose-1-phosphatase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016791 - phosphatase activity
GO:0050308 - sugar-phosphatase activity
GO:0000287 - magnesium ion binding
biological_process GO:0016311 - dephosphorylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11441N
ECOCYC:
G6425-MONOMER
ECOLIWIKI:
b0822
INTERPRO:
IPR036412
INTERPRO:
IPR023214
INTERPRO:
IPR006379
INTERPRO:
IPR000150
MODBASE:
P75792
PDB:
2HF2
PDB:
1RLT
PDB:
1RLO
PDB:
1RLM
PFAM:
PF08282
PRIDE:
P75792
PRODB:
PRO_000024014
PROSITE:
PS01229
PROTEINMODELPORTAL:
P75792
REFSEQ:
NP_415343
SMR:
P75792
UNIPROT:
P75792


Operon      
Name: ybiV         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybiUp5 859100 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybiUp7 859104 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybiUp6 859106 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybiVp5 860088 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB