RegulonDB RegulonDB 10.7: Gene Form
   

ybiW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybiW ybiY ybiV ybiWp4 ybiWp4 ybiVp5 ybiVp5

Gene      
Name: ybiW    Texpresso search in the literature
Synonym(s): ECK0813, G6426, b0823, pflF
Genome position(nucleotides): 860174 <-- 862606 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.99
External database links:  
ASAP:
ABE-0002810
ECHOBASE:
EB3112
OU-MICROARRAY:
b0823
PORTECO:
ybiW
REGULONDB:
b0823
STRING:
511145.b0823
M3D: ybiW
COLOMBOS: ybiW
PortEco: b0823


Product      
Name: putative pyruvate formate lyase
Synonym(s): PflF, YbiW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 90.125
Isoelectric point: 5.817
Motif(s):
 
Type Positions Sequence
689 -> 810 EGASPASGTDHLGPTAVIGSVGKLPTAAILGGVLLNQKLNPATLENESDKQKLMILLRTFFEVHKGWHIQYNIVSRETLLDAKKHPDQYRDLVVRVAGYSAFFTALSPDAQDDIIARTEHML
11 -> 682 DRIKAHKNALVHIVKPPVCTERAQHYTEMYQQHLDKPIPVRRALALAHHLANRTIWIKHDELIIGNQASEVRAAPIFPEYTVSWIEKEIDDLADRPGAGFAVSEENKRVLHEVCPWWRGQTVQDRCYGMFTDEQKGLLATGIIKAEGNMTSGDAHLAVNFPLLLEKGLDGLREEVAERRSRINLTVLEDLHGEQFLKAIDIVLVAVSEHIERFAALAREMAATETRESRRDELLAMAENCDLIAHQPPQTFWQALQLCYFIQLILQIESNGHSVSFGRMDQYLYPYYRRDVELNQTLDREHAIEMLHSCWLKLLEVNKIRSGSHSKASAGSPLYQNVTIGGQNLVDGQPMDAVNPLSYAILESCGRLRSTQPNLSVRYHAGMSNDFLDACVQVIRCGFGMPAFNNDEIVIPEFIKLGIEPQDAYDYAAIGCIETAVGGKWGYRCTGMSFINFARVMLAALEGGHDATSGKVFLPQEKALSAGNFNNFDEVMDAWDTQIRYYTRKSIEIEYVVDTMLEENVHDILCSALVDDCIERAKSIKQGGAKYDWVSGLQVGIANLGNSLAAVKKLVFEQGAIGQQQLAAALADDFDGLTHEQLRQRLINGAPKYGNDDDTVDTLLARAYQTYIDELKQYHNPRYGRGPVGGNYYAGTSSISANVPFGAQTMATPDGRK
688 -> 791 AEGASPASGTDHLGPTAVIGSVGKLPTAAILGGVLLNQKLNPATLENESDKQKLMILLRTFFEVHKGWHIQYNIVSRETLLDAKKHPDQYRDLVVRVAGYSAFF
10 -> 671 SDRIKAHKNALVHIVKPPVCTERAQHYTEMYQQHLDKPIPVRRALALAHHLANRTIWIKHDELIIGNQASEVRAAPIFPEYTVSWIEKEIDDLADRPGAGFAVSEENKRVLHEVCPWWRGQTVQDRCYGMFTDEQKGLLATGIIKAEGNMTSGDAHLAVNFPLLLEKGLDGLREEVAERRSRINLTVLEDLHGEQFLKAIDIVLVAVSEHIERFAALAREMAATETRESRRDELLAMAENCDLIAHQPPQTFWQALQLCYFIQLILQIESNGHSVSFGRMDQYLYPYYRRDVELNQTLDREHAIEMLHSCWLKLLEVNKIRSGSHSKASAGSPLYQNVTIGGQNLVDGQPMDAVNPLSYAILESCGRLRSTQPNLSVRYHAGMSNDFLDACVQVIRCGFGMPAFNNDEIVIPEFIKLGIEPQDAYDYAAIGCIETAVGGKWGYRCTGMSFINFARVMLAALEGGHDATSGKVFLPQEKALSAGNFNNFDEVMDAWDTQIRYYTRKSIEIEYVVDTMLEENVHDILCSALVDDCIERAKSIKQGGAKYDWVSGLQVGIANLGNSLAAVKKLVFEQGAIGQQQLAAALADDFDGLTHEQLRQRLINGAPKYGNDDDTVDTLLARAYQTYIDELKQYHNPRYGRGPVGGNYYAGTSSISANVPFG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0008861 - formate C-acetyltransferase activity
biological_process GO:0005975 - carbohydrate metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
G6426-MONOMER
ECOLIWIKI:
b0823
INTERPRO:
IPR005949
INTERPRO:
IPR004184
INTERPRO:
IPR001150
INTERPRO:
IPR010098
INTERPRO:
IPR019777
MODBASE:
P75793
PFAM:
PF02901
PFAM:
PF01228
PRIDE:
P75793
PROSITE:
PS51554
PROSITE:
PS51149
PROSITE:
PS00850
PROTEINMODELPORTAL:
P75793
REFSEQ:
NP_415344
SMR:
P75793
UNIPROT:
P75793


Operon      
Name: ybiYW         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybiVp5 860088 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybiWp4 862783 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB