RegulonDB RegulonDB 10.7: Gene Form
   

fsaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybiY moeB fsaA TSS_981 TSS_981 fsaAp6 fsaAp6 ybiWp4 ybiWp4

Gene      
Name: fsaA    Texpresso search in the literature
Synonym(s): ECK0815, G6428, b0825, fsa, mipB, ybiZ
Genome position(nucleotides): 863642 --> 864304 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.15
External database links:  
ASAP:
ABE-0002818
ECHOBASE:
EB3244
OU-MICROARRAY:
b0825
PORTECO:
fsaA
REGULONDB:
b0825
STRING:
511145.b0825
M3D: fsaA
COLOMBOS: fsaA
PortEco: b0825


Product      
Name: fructose-6-phosphate aldolase 1
Synonym(s): Fsa, FsaA, MipB, YbiZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.997
Isoelectric point: 6.262
Motif(s):
 
Type Positions Sequence
3 -> 205 LYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVA
85 -> 85 K

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0016832 - aldehyde-lyase activity
GO:0097023 - fructose 6-phosphate aldolase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006000 - fructose metabolic process
External database links:  
DIP:
DIP-10218N
ECOCYC:
G6428-MONOMER
ECOLIWIKI:
b0825
INTERPRO:
IPR013785
INTERPRO:
IPR004731
INTERPRO:
IPR001585
INTERPRO:
IPR023001
INTERPRO:
IPR033919
INTERPRO:
IPR018225
MODBASE:
P78055
PANTHER:
PTHR10683
PDB:
5ZOL
PDB:
4S1F
PDB:
4RZ4
PDB:
4RXG
PDB:
4RXF
PDB:
1L6W
PFAM:
PF00923
PRIDE:
P78055
PRODB:
PRO_000022709
PROSITE:
PS00958
PROSITE:
PS01054
PROTEINMODELPORTAL:
P78055
REFSEQ:
NP_415346
SMR:
P78055
UNIPROT:
P78055


Operon      
Name: fsaA         
Operon arrangement:
Transcription unit        Promoter
fsaA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybiWp4 862783 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter fsaAp6 863530 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_981 863614 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB