RegulonDB RegulonDB 10.8: Gene Form
   

gsiD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeI gsiC gsiD yliEp6 yliEp6

Gene      
Name: gsiD    Texpresso search in the literature
Synonym(s): ECK0822, G6432, b0832, yliD
Genome position(nucleotides): 871890 --> 872801 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.07
External database links:  
ASAP:
ABE-0002836
ECHOBASE:
EB3248
OU-MICROARRAY:
b0832
PortEco:
gsiD
STRING:
511145.b0832
COLOMBOS: gsiD


Product      
Name: glutathione ABC transporter membrane subunit GsiD
Synonym(s): GsiD, YliD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 33.238
Isoelectric point: 10.058
Motif(s):
 
Type Positions Sequence
105 -> 125 LAAGVFAVFIGAAIGTLLGLL
266 -> 286 VIAPHVAVFPALAIFLTVLAF
40 -> 60 AMTAALFVILLIVVAIFARWI
101 -> 290 AQISLAAGVFAVFIGAAIGTLLGLLAGYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAVAIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTVLLRHILPGTVSSIVVFFTMRIGTSIISAASLSFLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLG
222 -> 242 IVVFFTMRIGTSIISAASLSF

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0034634 - glutathione transmembrane transporter activity
GO:0071916 - dipeptide transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
GO:0034775 - glutathione transmembrane transport
GO:0035442 - dipeptide transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
YLID-MONOMER
ECOLIWIKI:
b0832
INTERPRO:
IPR035906
INTERPRO:
IPR025966
INTERPRO:
IPR000515
PFAM:
PF00528
PFAM:
PF12911
PRIDE:
P75799
PRODB:
PRO_000022847
PROSITE:
PS50928
REFSEQ:
NP_415353
SMR:
P75799
UNIPROT:
P75799


Operon      
Name: iaaA-gsiABCD         
Operon arrangement:
Transcription unit        Promoter
iaaA-gsiABCD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yliEp6 872969 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB