RegulonDB RegulonDB 10.8: Gene Form
   

pdeI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeI dgcI gsiD yliEp6 yliEp6

Gene      
Name: pdeI    Texpresso search in the literature
Synonym(s): ECK0823, G6433, b0833, yliE
Genome position(nucleotides): 872979 --> 875327 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.59
External database links:  
ASAP:
ABE-0002839
ECHOBASE:
EB3249
OU-MICROARRAY:
b0833
PortEco:
yliE
STRING:
511145.b0833
COLOMBOS: pdeI


Product      
Name: putative c-di-GMP phosphodiesterase PdeI
Synonym(s): PdeI, YliE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 90.048
Isoelectric point: 5.525
Motif(s):
 
Type Positions Sequence
35 -> 150 VSERAVKRADSRFELIQKNVGYFFKDIERSALTLKDSLYLLKNTEEIQRAVILKMEMMPFLDSVGLVLDDNKYYLFSRRANDKIVVYHQEQVNGPLVDESGRVIFADFNPSKRPWS
527 -> 781 NIWIARNIRHAMEIGELFLVYQPIVDINTRAILGAEALCRWVSAERGIISPLKFITIAEDIGFINELGYQIIKTAMGEFRHFSQRASLKDDFLLHINVSPWQLNEPHFHERFTTIMKENGLKANSLCVEITETVIERINEHFYLNIEQLRKQGVRISIDDFGTGLSNLKRFYEINPDSIKVDSQFTGDIFGTAGKIVRIIFDLARYNRIPVIAEGVESEDVARELIKLGCVQAQGYLYQKPMPFSAWDKSGKLVK
532 -> 767 RNIRHAMEIGELFLVYQPIVDINTRAILGAEALCRWVSAERGIISPLKFITIAEDIGFINELGYQIIKTAMGEFRHFSQRASLKDDFLLHINVSPWQLNEPHFHERFTTIMKENGLKANSLCVEITETVIERINEHFYLNIEQLRKQGVRISIDDFGTGLSNLKRFYEINPDSIKVDSQFTGDIFGTAGKIVRIIFDLARYNRIPVIAEGVESEDVARELIKLGCVQAQGYLYQKP
12 -> 32 LIILFLLAALSFIGLFFIINY
286 -> 306 LFYLPFAFIIIVLLVVYLMTT

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016787 - hydrolase activity
GO:0071111 - cyclic-guanylate-specific phosphodiesterase activity
Note(s): Note(s): ...[more].
Reference(s): [1] Alper H., et al., 2008
External database links:  
ECOCYC:
G6433-MONOMER
ECOLIWIKI:
b0833
INTERPRO:
IPR033418
INTERPRO:
IPR035919
INTERPRO:
IPR001633
PFAM:
PF17153
PFAM:
PF00563
PRIDE:
P75800
PROSITE:
PS50883
REFSEQ:
NP_415354
SMART:
SM00052
SMR:
P75800
UNIPROT:
P75800


Operon      
Name: pdeI-dgcI         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yliEp6 872969 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Alper H., Stephanopoulos G., 2008, Uncovering the gene knockout landscape for improved lycopene production in E. coli., Appl Microbiol Biotechnol 78(5):801-10

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB