RegulonDB RegulonDB 10.7: Gene Form
   

dgcI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeI dgcI rimO

Gene      
Name: dgcI    Texpresso search in the literature
Synonym(s): ECK0824, G6434, b0834, yliF
Genome position(nucleotides): 875335 --> 876663 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.49
External database links:  
ASAP:
ABE-0002841
ECHOBASE:
EB3250
OU-MICROARRAY:
b0834
PORTECO:
yliF
REGULONDB:
b0834
STRING:
511145.b0834
M3D: dgcI
COLOMBOS: dgcI
PortEco: b0834


Product      
Name: putative diguanylate cyclase DgcI
Synonym(s): DgcI, YliF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 49.873
Isoelectric point: 8.229
Motif(s):
 
Type Positions Sequence
24 -> 442 CGIYTQMVKERVYSLKQSVIDTAFAVANIAEYRRSVAIDLINTLNPTEEQLLVGLRTAYADSVSPSYLYDVGPYLISSDECIQVKEFEKNYCADIMQVVKYRHVKNTGFISFDGKTFVYYLYPVTHNRSLIFLLGLERFSLLSKSLAMDSENLMFSLFKNGKPVTGDEYNAKNAIFTVSEAMEHFAYLPTGLYVFAYKKDVYLRVCTLIIFFAALVAVISGASCLYLVRRVINRGIVEKEAIINNHFERVLDGGLFFSAADVKKLYSMYNSAFLDDLTKAMGRKSFDEDLKALPEKGGYLCLFDVDKFKNINDTFGHLLGDEVLMKVVKILKSQIPVDKGKVYRFGGDEFAVIYTGGTLEELLSILKEIVHFQVGSINLSTSIGVAHSNECPTVERLKMLADERLYKSKKNGRAQISWQ
231 -> 251 LIIFFAALVAVISGASCLYLV
319 -> 442 KGGYLCLFDVDKFKNINDTFGHLLGDEVLMKVVKILKSQIPVDKGKVYRFGGDEFAVIYTGGTLEELLSILKEIVHFQVGSINLSTSIGVAHSNECPTVERLKMLADERLYKSKKNGRAQISWQ
295 -> 437 AFLDDLTKAMGRKSFDEDLKALPEKGGYLCLFDVDKFKNINDTFGHLLGDEVLMKVVKILKSQIPVDKGKVYRFGGDEFAVIYTGGTLEELLSILKEIVHFQVGSINLSTSIGVAHSNECPTVERLKMLADERLYKSKKNGRA
1 -> 23 MSRINKFVLTVSLLIFIMISAVA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0052621 - diguanylate cyclase activity
biological_process GO:0043709 - cell adhesion involved in single-species biofilm formation
GO:1902201 - negative regulation of bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Reference(s): [1] Povolotsky TL., et al., 2015
External database links:  
ECOCYC:
G6434-MONOMER
ECOLIWIKI:
b0834
INTERPRO:
IPR000160
INTERPRO:
IPR029787
INTERPRO:
IPR033422
PFAM:
PF17156
PFAM:
PF00990
PRIDE:
P75801
PROSITE:
PS51257
PROSITE:
PS50887
PROTEINMODELPORTAL:
P75801
REFSEQ:
NP_415355
SMART:
SM00267
SMR:
P75801
UNIPROT:
P75801


Operon      
Name: pdeI-dgcI         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Povolotsky TL., Hengge R., 2015, Genome-Based Comparison of Cyclic Di-GMP Signaling in Pathogenic and Commensal Escherichia coli Strains., J Bacteriol 198(1):111-26


RegulonDB