RegulonDB RegulonDB 10.7: Gene Form
   

rimO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcI rimO bssR anti-terminator anti-anti-terminator TSS_985 TSS_985 bssRp5 bssRp5 TSS_984 TSS_984 rimOp rimOp

Gene      
Name: rimO    Texpresso search in the literature
Synonym(s): ECK0825, G6435, b0835, yliG
Genome position(nucleotides): 876710 <-- 878035 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.64
External database links:  
ASAP:
ABE-0002843
ECHOBASE:
EB3251
OU-MICROARRAY:
b0835
PORTECO:
rimO
REGULONDB:
b0835
STRING:
511145.b0835
M3D: rimO
COLOMBOS: rimO
PortEco: b0835


Product      
Name: ribosomal protein S12 methylthiotransferase RimO
Synonym(s): RimO, YliG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 49.582
Isoelectric point: 5.169
Motif(s):
 
Type Positions Sequence
376 -> 441 QEKVGREILVIIDEVDEEGAIGRSMADAPEIDGAVYLNGETNVKPGDILRVKVEHADEYDLWGSRV
146 -> 323 ISEGCNHRCTFCIIPSMRGDLVSRPIGEVLSEAKRLVDAGVKEILVISQDTSAYGVDVKHRTGFHNGEPVKTSMVSLCEQLSKLGIWTRLHYVYPYPHVDDVIPLMAEGKILPYLDIPLQHASPRILKLMKRPGSVDRQLARIKQWREICPELTLRSTFIVGFPGETEEDFQMLLDFL
379 -> 441 VGREILVIIDEVDEEGAIGRSMADAPEIDGAVYLNGETNVKPGDILRVKVEHADEYDLWGSRV
8 -> 118 PKIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKVIVTGCLGAKEDQIREVHPKVLEITGPHSYEQVLEHVHHYVP
9 -> 95 KIGFVSLGCPKNLVDSERILTELRTEGYDVVPSYDDADMVIVNTCGFIDSAVQESLEAIGEALNENGKVIVTGCLGAKEDQIREVHP

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0103039 - protein methylthiotransferase activity
GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0035596 - methylthiotransferase activity
GO:0035599 - aspartic acid methylthiotransferase activity
biological_process GO:0006400 - tRNA modification
GO:0018339 - peptidyl-L-beta-methylthioaspartic acid biosynthetic process from peptidyl-aspartic acid
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48218N
ECOCYC:
G6435-MONOMER
ECOLIWIKI:
b0835
INTERPRO:
IPR005840
INTERPRO:
IPR002792
INTERPRO:
IPR005839
INTERPRO:
IPR041582
INTERPRO:
IPR006638
INTERPRO:
IPR007197
INTERPRO:
IPR013848
INTERPRO:
IPR020612
INTERPRO:
IPR023404
INTERPRO:
IPR038135
MODBASE:
P0AEI4
PANTHER:
PTHR43837
PFAM:
PF04055
PFAM:
PF18693
PFAM:
PF00919
PRIDE:
P0AEI4
PRODB:
PRO_000023763
PROSITE:
PS50926
PROSITE:
PS51449
PROSITE:
PS01278
PROTEINMODELPORTAL:
P0AEI4
REFSEQ:
NP_415356
SMART:
SM00729
SMR:
P0AEI4
UNIPROT:
P0AEI4


Operon      
Name: rimO         
Operon arrangement:
Transcription unit        Promoter
rimO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_984 878217 forward nd [RS-EPT-CBR] [1]
  promoter bssRp5 878246 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_985 878396 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB