RegulonDB RegulonDB 10.7: Gene Form
   

bssR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rimO yliI bssR gstB terminator anti-terminator anti-anti-terminator TSS_986 TSS_986 TSS_985 TSS_985 bssRp5 bssRp5 TSS_984 TSS_984 rimOp rimOp

Gene      
Name: bssR    Texpresso search in the literature
Synonym(s): ECK0826, G6436, b0836, yliH
Genome position(nucleotides): 878248 --> 878631 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.7
External database links:  
ASAP:
ABE-0002849
ECHOBASE:
EB3252
OU-MICROARRAY:
b0836
PORTECO:
bssR
REGULONDB:
b0836
STRING:
511145.b0836
M3D: bssR
COLOMBOS: bssR
PortEco: b0836


Product      
Name: regulator of biofilm formation
Synonym(s): BssR, YliH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.536
Isoelectric point: 6.956
Motif(s):
 
Type Positions Sequence
1 -> 126 MFVDRQRIDLLNRLIDARVDLAAYVQLRKAKGYMSVSESNHLRDNFFKLNRELHDKSLRLNLHLDQEEWSALHHAEEALATAAVCLMSGHHDCPTVITVNADKLENCLMSLTLSIQSLQKHAMLEK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0010468 - regulation of gene expression
GO:1900190 - regulation of single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Domka J., et al., 2006
[2] Selinger DW., et al., 2000
External database links:  
ECOCYC:
G6436-MONOMER
ECOLIWIKI:
b0836
INTERPRO:
IPR020359
PFAM:
PF10799
PRIDE:
P0AAY1
PRODB:
PRO_000022232
PRODOM:
PD079626
PROTEINMODELPORTAL:
P0AAY1
REFSEQ:
NP_415357
SMR:
P0AAY1
UNIPROT:
P0AAY1


Operon      
Name: bssR         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_984 878217 forward nd [RS-EPT-CBR] [3]
  promoter bssRp5 878246 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_985 878396 forward nd [RS-EPT-CBR] [3]
  promoter TSS_986 878722 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Domka J., Lee J., Wood TK., 2006, YliH (BssR) and YceP (BssS) Regulate Escherichia coli K-12 Biofilm Formation by Influencing Cell Signaling., Appl Environ Microbiol 72(4):2449-59

 [2] Selinger DW., Cheung KJ., Mei R., Johansson EM., Richmond CS., Blattner FR., Lockhart DJ., Church GM., 2000, RNA expression analysis using a 30 base pair resolution Escherichia coli genome array., Nat Biotechnol 18(12):1262-8

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB