RegulonDB RegulonDB 10.7: Gene Form
   

gstB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dacC yliI gstB bssR terminator anti-terminator anti-anti-terminator dacCp dacCp TSS_988 TSS_988 gstBp gstBp TSS_986 TSS_986 TSS_985 TSS_985

Gene      
Name: gstB    Texpresso search in the literature
Synonym(s): ECK0828, G6438, b0838, yliJ
Genome position(nucleotides): 879854 <-- 880480 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.99
External database links:  
ASAP:
ABE-0002855
ECHOBASE:
EB3254
OU-MICROARRAY:
b0838
PORTECO:
yliJ
REGULONDB:
b0838
STRING:
511145.b0838
M3D: gstB
COLOMBOS: gstB
PortEco: b0838


Product      
Name: glutathione S-transferase GstB
Synonym(s): GstB, YliJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.713
Isoelectric point: 4.8
Motif(s):
 
Type Positions Sequence
1 -> 83 MITLWGRNNSTNVKKVLLTLEELELPYEQILAGREFGINHDADFLAMNPNGLVPLLRDDESDLILWESNAIVRYLAAQYGQKR
121 -> 197 PPEERDQAAIDASCKECDALFALLDAELAKVKWFSGDEFGVGDIAIAPFIYNLFNVGLTWTPRPNLQRWYQQLTERP
67 -> 68 ES
6 -> 82 GRNNSTNVKKVLLTLEELELPYEQILAGREFGINHDADFLAMNPNGLVPLLRDDESDLILWESNAIVRYLAAQYGQK
88 -> 208 SPARRAEAEKWMDWANQTLSNAHRGILMGLVRTPPEERDQAAIDASCKECDALFALLDAELAKVKWFSGDEFGVGDIAIAPFIYNLFNVGLTWTPRPNLQRWYQQLTERPAVRKVVMIPVS

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0004364 - glutathione transferase activity
GO:0030611 - arsenate reductase activity
GO:0042802 - identical protein binding
GO:0043295 - glutathione binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Rife CL., et al., 2003
External database links:  
DIP:
DIP-48220N
ECOCYC:
G6438-MONOMER
ECOLIWIKI:
b0838
INTERPRO:
IPR036282
INTERPRO:
IPR010987
INTERPRO:
IPR004046
INTERPRO:
IPR004045
INTERPRO:
IPR036249
MODBASE:
P0ACA7
PFAM:
PF13417
PFAM:
PF00043
PRIDE:
P0ACA7
PROSITE:
PS50405
PROSITE:
PS50404
PROTEINMODELPORTAL:
P0ACA7
REFSEQ:
NP_415359
SMR:
P0ACA7
UNIPROT:
P0ACA7


Operon      
Name: gstB         
Operon arrangement:
Transcription unit        Promoter
gstB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_985 878396 forward nd [RS-EPT-CBR] [2]
  promoter TSS_986 878722 forward nd [RS-EPT-CBR] [2]
  promoter TSS_988 880618 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Rife CL., Parsons JF., Xiao G., Gilliland GL., Armstrong RN., 2003, Conserved structural elements in glutathione transferase homologues encoded in the genome of Escherichia coli., Proteins 53(4):777-82

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB