RegulonDB RegulonDB 10.7: Gene Form
   

ybjG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdfA deoR ybjG PhoP terminator cmrp cmrp cmrp2 cmrp2 ybjGp ybjGp TSS_990 TSS_990 TSS_989 TSS_989

Gene      
Name: ybjG    Texpresso search in the literature
Synonym(s): ECK0831, G6439, b0841
Genome position(nucleotides): 882792 <-- 883388 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.59
External database links:  
ASAP:
ABE-0002865
ECHOBASE:
EB3440
OU-MICROARRAY:
b0841
PORTECO:
ybjG
REGULONDB:
b0841
STRING:
511145.b0841
M3D: ybjG
COLOMBOS: ybjG
PortEco: b0841


Product      
Name: undecaprenyl pyrophosphate phosphatase
Synonym(s): BcrCEC, YbjG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 22.399
Isoelectric point: 8.507
Motif(s):
 
Type Positions Sequence
150 -> 172 MLGGLLAGMIGCLSAQIIWQAMG
28 -> 48 IFIAKDLITVVPLLAVVLWLW
121 -> 143 RLWSGSLLMVLAVVIAWSRVYLG
58 -> 165 IKIAIALAVSLFVSWTMGHLFPHDRPFVENIGYNFLHHAADDSFPSDHGTVIFTFALAFLCWHRLWSGSLLMVLAVVIAWSRVYLGVHWPLDMLGGLLAGMIGCLSAQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016787 - hydrolase activity
GO:0050380 - undecaprenyl-diphosphatase activity
biological_process GO:0009252 - peptidoglycan biosynthetic process
GO:0046677 - response to antibiotic
GO:0008360 - regulation of cell shape
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] El Ghachi M., et al., 2005
[2] Kim SM., et al., 2015
[3] Wang D., et al., 2013
External database links:  
ECOCYC:
G6439-MONOMER
ECOLIWIKI:
b0841
INTERPRO:
IPR033879
INTERPRO:
IPR000326
INTERPRO:
IPR036938
MODBASE:
P75806
PFAM:
PF01569
PRIDE:
P75806
PROTEINMODELPORTAL:
P75806
REFSEQ:
NP_415362
SMART:
SM00014
SMR:
P75806
UNIPROT:
P75806


Operon      
Name: ybjG         
Operon arrangement:
Transcription unit        Promoter
ybjG


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_989 882763 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_990 883505 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] El Ghachi M., Derbise A., Bouhss A., Mengin-Lecreulx D., 2005, Identification of multiple genes encoding membrane proteins with undecaprenyl pyrophosphate phosphatase (UppP) activity in Escherichia coli., J Biol Chem 280(19):18689-95

 [2] Kim SM., Choi BY., Ryu YS., Jung SH., Park JM., Kim GH., Lee SK., 2015, Simultaneous utilization of glucose and xylose via novel mechanisms in engineered Escherichia coli., Metab Eng 30:141-8

 [3] Wang D., Hu E., Chen J., Tao X., Gutierrez K., Qi Y., 2013, Characterization of novel ybjG and dacC variants in Escherichia coli., J Med Microbiol 62(Pt 11):1728-34

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB