RegulonDB RegulonDB 10.7: Gene Form
   

ybjH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdfA ybjI ybjH

Gene      
Name: ybjH    Texpresso search in the literature
Synonym(s): ECK0833, G6441, b0843
Genome position(nucleotides): 884946 <-- 885230 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.98
External database links:  
ASAP:
ABE-0002873
ECHOBASE:
EB3441
OU-MICROARRAY:
b0843
PORTECO:
ybjH
REGULONDB:
b0843
STRING:
511145.b0843
M3D: ybjH
COLOMBOS: ybjH
PortEco: b0843


Product      
Name: uncharacterized protein YbjH
Synonym(s): YbjH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 9.971
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
1 -> 22 MIMKNCLLLGALLMGFTGVAMA
23 -> 94 QSVTVDVPSGYKVVVVPDSVSVPQAVSVATVPQTVYVAPAPAPAYRPHPYVRHLASVGEGMVIEHQIDDHHH

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6441-MONOMER
ECOLIWIKI:
b0843
PRIDE:
P0AAY4
PROTEINMODELPORTAL:
P0AAY4
REFSEQ:
NP_415364
UNIPROT:
P0AAY4


Operon      
Name: ybjH         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB