RegulonDB RegulonDB 10.7: Gene Form
   

ybjI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybjJ ybjI rcdA ybjH terminator

Gene      
Name: ybjI    Texpresso search in the literature
Synonym(s): ECK0834, G6442, b0844
Genome position(nucleotides): 885316 <-- 886131 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.59
External database links:  
ASAP:
ABE-0002877
ECHOBASE:
EB3442
OU-MICROARRAY:
b0844
PORTECO:
ybjI
REGULONDB:
b0844
STRING:
511145.b0844
M3D: ybjI
COLOMBOS: ybjI
PortEco: b0844


Product      
Name: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase
Synonym(s): YbjI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.196
Isoelectric point: 4.596
Motif(s):
 
Type Positions Sequence
6 -> 259 IAVDMDGTFLSDQKTYNRERFMAQYQQMKAQGIRFVVASGNQYYQLISFFPEIANEIAFVAENGGWVVSEGKDVFNGELSKDAFATVVEHLLTRPEVEIIACGKNSAYTLKKYDDAMKTVAEMYYHRLEYVDNFDNLEDIFFKFGLNLSDELIPQVQKALHEAIGDIMVSVHTGNGSIDLIIPGVHKANGLRQLQKLWGIDDSEVVVFGDGGNDIEMLRQAGFSFAMENAGSAVVAAAKYRAGSNNREGVLDVI
44 -> 45 SG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.9 - riboflavin
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016791 - phosphatase activity
GO:0000287 - magnesium ion binding
GO:0043726 - 5-amino-6-(5-phosphoribitylamino)uracil phosphatase activity
biological_process GO:0009231 - riboflavin biosynthetic process
GO:0016311 - dephosphorylation
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Kuznetsova E., et al., 2005
External database links:  
DIP:
DIP-11451N
ECOCYC:
G6442-MONOMER
ECOLIWIKI:
b0844
INTERPRO:
IPR000150
INTERPRO:
IPR006379
INTERPRO:
IPR036412
INTERPRO:
IPR023214
MODBASE:
P75809
PFAM:
PF08282
PRIDE:
P75809
PROSITE:
PS01229
PROTEINMODELPORTAL:
P75809
REFSEQ:
NP_415365
SMR:
P75809
SWISSMODEL:
P75809
UNIPROT:
P75809


Operon      
Name: ybjJI         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Kuznetsova E., Proudfoot M., Sanders SA., Reinking J., Savchenko A., Arrowsmith CH., Edwards AM., Yakunin AF., 2005, Enzyme genomics: Application of general enzymatic screens to discover new enzymes., FEMS Microbiol Rev 29(2):263-79


RegulonDB