RegulonDB RegulonDB 10.8: Gene Form
   

ybjJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybjJ ybjI rcdA ybjH terminator

Gene      
Name: ybjJ    Texpresso search in the literature
Synonym(s): ECK0835, G6443, b0845
Genome position(nucleotides): 886131 <-- 887339 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.92
External database links:  
ASAP:
ABE-0002880
ECHOBASE:
EB3443
OU-MICROARRAY:
b0845
PortEco:
ybjJ
STRING:
511145.b0845
COLOMBOS: ybjJ


Product      
Name: inner membrane protein YbjJ
Synonym(s): YbjJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 41.852
Isoelectric point: 9.019
Motif(s):
 
Type Positions Sequence
49 -> 71 MGGVLFGLSIGSMSGILCSAWLV
78 -> 100 NVILVTMSCALIGMMILSLALWL
165 -> 187 GVPATVHILLAALVGIAPIYIAI
223 -> 388 VVLAMAFAEGSANDWLPLLMVDGHGFSPTSGSLIYAGFTLGMTVGRFTGGWFIDRYSRVAVVRASALMGALGIGLIIFVDSAWVAGVSVVLWGLGASLGFPLTISAASDTGPDAPTRVSVVATTGYLAFLVGPPLLGYLGEHYGLRSAMLVVLALVILAAIVAKAV
253 -> 275 GSLIYAGFTLGMTVGRFTGGWFI

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
G6443-MONOMER
ECOLIWIKI:
b0845
INTERPRO:
IPR011701
INTERPRO:
IPR036259
INTERPRO:
IPR020846
MODBASE:
P75810
PFAM:
PF07690
PRIDE:
P75810
PROSITE:
PS50850
REFSEQ:
NP_415366
SMR:
P75810
UNIPROT:
P75810


Operon      
Name: ybjJI         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB