RegulonDB RegulonDB 10.7: Gene Form
   

rcdA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybjJ rcdA rybB terminator rybBp rybBp

Gene      
Name: rcdA    Texpresso search in the literature
Synonym(s): ECK0836, G6444, b0846, ybjK
Genome position(nucleotides): 887423 --> 887959 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.58
External database links:  
ASAP:
ABE-0002885
ECHOBASE:
EB3444
OU-MICROARRAY:
b0846
PORTECO:
ybjK
REGULONDB:
b0846
STRING:
511145.b0846
M3D: rcdA
COLOMBOS: rcdA
PortEco: b0846


Product      
Name: DNA-binding transcriptional regulator RcdA
Synonym(s): RcdA, YbjK
Sequence: Get amino acid sequence Fasta Format
Regulator Family: TetR/AcrR
Cellular location: cytosol
Molecular weight: 20.307
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
7 -> 67 PQRREKIIQATLEAVKLYGIHAVTHRKIATLAGVPLGSMTYYFSGIDELLLEAFSSFTEIM
13 -> 59 IIQATLEAVKLYGIHAVTHRKIATLAGVPLGSMTYYFSGIDELLLEA
30 -> 49 THRKIATLAGVPLGSMTYYF

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[APPH] Assay of protein purified to homogeneity
[IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Perez-Rueda E., et al., 2004
[2] Shimada T., et al., 2012
External database links:  
ECOCYC:
G6444-MONOMER
ECOLIWIKI:
b0846
INTERPRO:
IPR001647
INTERPRO:
IPR036271
INTERPRO:
IPR009057
MODBASE:
P75811
PANTHER:
PTHR30328
PDB:
5X5I
PFAM:
PF00440
PRIDE:
P75811
PROSITE:
PS50977
PROTEINMODELPORTAL:
P75811
REFSEQ:
NP_415367
SMR:
P75811
UNIPROT:
P75811


Operon      
Name: rcdA         
Operon arrangement:
Transcription unit        Promoter
ybjK


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [2] Shimada T., Katayama Y., Kawakita S., Ogasawara H., Nakano M., Yamamoto K., Ishihama A., 2012, A novel regulator RcdA of the csgD gene encoding the master regulator of biofilm formation in Escherichia coli., Microbiologyopen 1(4):381-94


RegulonDB