RegulonDB RegulonDB 10.7: Gene Form
   

ybjL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybjL ybjM rybB DksA DksA-ppGpp DksA-ppGpp terminator TSS_999 TSS_999 ybjLp10 ybjLp10 ybjMp4 ybjMp4 ybjLp12 ybjLp12 TSS_998 TSS_998 ybjMp8 ybjMp8 TSS_997 (cluster) TSS_997 (cluster) TSS_996 TSS_996 TSS_995 TSS_995 TSS_994 (cluster) TSS_994 (cluster) TSS_993 TSS_993 TSS_992 TSS_992 rybBp rybBp

Gene      
Name: ybjL    Texpresso search in the literature
Synonym(s): ECK0838, G6445, b0847
Genome position(nucleotides): 888134 <-- 889819 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.54
External database links:  
ASAP:
ABE-0002887
ECHOBASE:
EB3445
OU-MICROARRAY:
b0847
PORTECO:
ybjL
REGULONDB:
b0847
STRING:
511145.b0847
M3D: ybjL
COLOMBOS: ybjL
PortEco: b0847


Product      
Name: putative transport protein YbjL
Synonym(s): YbjL, inner membrane protein YbjL
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 60.351
Isoelectric point: 8.448
Motif(s):
 
Type Positions Sequence
17 -> 182 LFVVLALGLCLGKLRLGSIQLGNSIGVLVVSLLLGQQHFSINTDALNLGFMLFIFCVGVEAGPNFFSIFFRDGKNYLMLALVMVGSALVIALGLGKLFGWDIGLTAGMLAGSMTSTPVLVGAGDTLRHSGMESRQLSLALDNLSLGYALTYLIGLVSLIVGARYLP
32 -> 52 LGSIQLGNSIGVLVVSLLLGQ
385 -> 555 AFCAFFVIGLMIGMITFQFSTFSFGMGNAAGLLFAGIMLGFMRANHPTFGYIPQGALSMVKEFGLMVFMAGVGLSAGSGINNGLGAIGGQMLIAGLIVSLVPVVICFLFGAYVLRMNRALLFGAMMGARTCAPAMEIISDTARSNIPALGYAGTYAIANVLLTLAGTIIVM
383 -> 403 LLAFCAFFVIGLMIGMITFQF
522 -> 526 ISDTA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0008324 - cation transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
biological_process GO:0006813 - potassium ion transport
GO:0055085 - transmembrane transport
GO:0098655 - cation transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6445-MONOMER
ECOLIWIKI:
b0847
INTERPRO:
IPR006037
INTERPRO:
IPR006512
INTERPRO:
IPR023017
INTERPRO:
IPR036721
PFAM:
PF06826
PFAM:
PF02080
PRIDE:
P60869
PROSITE:
PS51202
PROTEINMODELPORTAL:
P60869
REFSEQ:
NP_415368
SMR:
P60869
UNIPROT:
P60869


Operon      
Name: ybjL         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_992 888924 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_993 888928 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_994 (cluster) 888947 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_995 888953 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_996 889468 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_997 (cluster) 889475 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter ybjMp8 889885 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_998 889888 forward nd [RS-EPT-CBR] [1]
  promoter ybjLp12 889938 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybjMp4 889940 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybjLp10 889941 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_999 889945 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB