RegulonDB RegulonDB 10.7: Gene Form
   

ybjN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

potF rimK ybjN potFp1 potFp1 potFp2 potFp2 TSS_1000 TSS_1000

Gene      
Name: ybjN    Texpresso search in the literature
Synonym(s): ECK0844, G6447, b0853
Genome position(nucleotides): 892957 --> 893433 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.43
External database links:  
ASAP:
ABE-0002910
ECHOBASE:
EB3447
OU-MICROARRAY:
b0853
PORTECO:
ybjN
REGULONDB:
b0853
STRING:
511145.b0853
M3D: ybjN
COLOMBOS: ybjN
PortEco: b0853


Product      
Name: protein YbjN
Synonym(s): YbjN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.666
Isoelectric point: 3.923
Motif(s):
 
Type Positions Sequence
9 -> 131 LDTLRQWLDDLGMSFFECDNCQALHLPHMQNFDGVFDAKIDLIDNTILFSAMAEVRPSAVLPLAADLSAINASSLTVKAFLDMQDDNLPKLVVCQSLSVMQGVTYEQFAWFVRQSEEQISMVI

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
biological_process GO:0009297 - pilus assembly
GO:0030308 - negative regulation of cell growth
GO:0010212 - response to ionizing radiation
GO:1900232 - negative regulation of single-species biofilm formation on inanimate substrate
GO:1902201 - negative regulation of bacterial-type flagellum-dependent cell motility
GO:1902208 - regulation of bacterial-type flagellum assembly
GO:1902209 - negative regulation of bacterial-type flagellum assembly
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6447-MONOMER
ECOLIWIKI:
b0853
INTERPRO:
IPR019660
PFAM:
PF10722
PRIDE:
P0AAY6
PROTEINMODELPORTAL:
P0AAY6
REFSEQ:
NP_415374
SMR:
P0AAY6
UNIPROT:
P0AAY6


Operon      
Name: ybjC-nfsA-rimK-ybjN         
Operon arrangement:
Transcription unit        Promoter
ybjC-nfsA-rimK-ybjN
rimK-ybjN
ybjN


Transcriptional Regulation      
Display Regulation             
Activated by: MarA, Rob, SoxS
Repressed by: OxyR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1000 892926 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB