RegulonDB RegulonDB 10.8: Gene Form
   

ybjO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlmC potI ybjO potH terminator anti-terminator anti-anti-terminator ybjOp5 ybjOp5 ybjOp4 ybjOp4

Gene      
Name: ybjO    Texpresso search in the literature
Synonym(s): ECK0849, G6448, b0858
Genome position(nucleotides): 897989 --> 898477 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.15
External database links:  
ASAP:
ABE-0002922
ECHOBASE:
EB3448
OU-MICROARRAY:
b0858
PortEco:
ybjO
STRING:
511145.b0858
COLOMBOS: ybjO


Product      
Name: putative inner membrane protein
Synonym(s): YbjO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 18.518
Isoelectric point: 10.145
Motif(s):
 
Type Positions Sequence
95 -> 115 WLYLLTQITAASYLWAASLGY
24 -> 44 LVQVAALAIIMIRGLDVLMIF
21 -> 160 VPALVQVAALAIIMIRGLDVLMIFNTLGVRGIGEFIHRSVQTWSLTLVFLSSLVLVFIEIWCAFSLVKGRRWARWLYLLTQITAASYLWAASLGYGYPELFSIPGESKREIFHSLMLQKLPDMLILMLLFVPSTSRRFFQ
67 -> 87 LVFLSSLVLVFIEIWCAFSLV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48193N
ECOCYC:
G6448-MONOMER
ECOLIWIKI:
b0858
INTERPRO:
IPR019703
MINT:
MINT-1308286
PFAM:
PF10767
PRIDE:
P0AAZ0
REFSEQ:
NP_415379
UNIPROT:
P0AAZ0


Operon      
Name: ybjO-rlmC         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybjOp4 897852 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybjOp5 897947 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB