RegulonDB RegulonDB 10.8: Gene Form
   

rlmC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlmC artJ ybjO TSS_1001 TSS_1001

Gene      
Name: rlmC    Texpresso search in the literature
Synonym(s): ECK0850, G6449, b0859, rumB, ybjF
Genome position(nucleotides): 898518 --> 899645 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.61
External database links:  
ASAP:
ABE-0002924
ECHOBASE:
EB3201
OU-MICROARRAY:
b0859
PortEco:
rlmC
STRING:
511145.b0859
COLOMBOS: rlmC


Product      
Name: 23S rRNA m5U747 methyltransferase
Synonym(s): RlmC, RumB, YbjF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.956
Isoelectric point: 7.088
Motif(s):
 
Type Positions Sequence
208 -> 374 QSFFQTNPAVASQLYATARDWVRQLPVKHMWDLFCGVGGFGLHCATPDMQLTGIEIASEAIACAKQSAAELGLTRLQFQALDSTQFATAQGDVPELVLVNPPRRGIGKPLCDYLSTMAPRFIIYSSCNAQTMAKDIRELPGFRIERVQLFDMFPHTAHYEVLTLLVK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008173 - RNA methyltransferase activity
GO:0016436 - rRNA (uridine) methyltransferase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0005506 - iron ion binding
GO:0070041 - rRNA (uridine-C5-)-methyltransferase activity
biological_process GO:0016070 - RNA metabolic process
GO:0031167 - rRNA methylation
GO:0006396 - RNA processing
GO:0006364 - rRNA processing
GO:0032259 - methylation
GO:0070475 - rRNA base methylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6449-MONOMER
ECOLIWIKI:
b0859
INTERPRO:
IPR010280
INTERPRO:
IPR030391
INTERPRO:
IPR030390
INTERPRO:
IPR029063
INTERPRO:
IPR011825
MODBASE:
P75817
PANTHER:
PTHR11061
PFAM:
PF05958
PRIDE:
P75817
PRODB:
PRO_000023896
PROSITE:
PS51687
PROSITE:
PS01231
PROSITE:
PS01230
REFSEQ:
NP_415380
SMR:
P75817
UNIPROT:
P75817


Operon      
Name: ybjO-rlmC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1001 900345 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB