RegulonDB RegulonDB 10.8: Gene Form
   

ybjP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

artP ybjP ybjQ amiD ArgR ArgR TSS_1021 (cluster) TSS_1021 (cluster) ybjPp ybjPp TSS_1020 (cluster) TSS_1020 (cluster) TSS_1019 TSS_1019 ybjQp ybjQp TSS_1017 TSS_1017 artPp3 artPp3 artPp2 artPp2 artPp1 artPp1 artPp artPp TSS_1016 TSS_1016 TSS_1015 TSS_1015 TSS_1014 TSS_1014 TSS_1013 TSS_1013 TSS_1012 TSS_1012 TSS_1011 TSS_1011 TSS_1010 TSS_1010 TSS_1009 TSS_1009 TSS_1008 TSS_1008

Gene      
Name: ybjP    Texpresso search in the literature
Synonym(s): ECK0856, G6450, b0865
Genome position(nucleotides): 903952 <-- 904467 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.88
External database links:  
ASAP:
ABE-0002941
ECHOBASE:
EB3449
OU-MICROARRAY:
b0865
PortEco:
ybjP
STRING:
511145.b0865
COLOMBOS: ybjP


Product      
Name: DUF3828 domain-containing lipoprotein YbjP
Synonym(s): YbjP
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 18.991
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
1 -> 18 MRYSKLTMLIPCALLLSA
40 -> 154 GPDNVAQQFYDYRILHRSNDITALRPYLSDKLATLLSDASRDNNHRELLTNDPFSSRTTLPDSAHVASASTIPNRDARNIPLRVDLKQGDQGWQDEVLMIQEGQCWVIDDVRYLG
19 -> 171 CTTVTPAYKDNGTRSGPCVEGGPDNVAQQFYDYRILHRSNDITALRPYLSDKLATLLSDASRDNNHRELLTNDPFSSRTTLPDSAHVASASTIPNRDARNIPLRVDLKQGDQGWQDEVLMIQEGQCWVIDDVRYLGGSVHATAGTLRQSIENR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6450-MONOMER
ECOLIWIKI:
b0865
INTERPRO:
IPR024289
PFAM:
PF12883
PRIDE:
P75818
PROSITE:
PS51257
REFSEQ:
NP_415386
SMR:
P75818
UNIPROT:
P75818


Operon      
Name: ybjP         
Operon arrangement:
Transcription unit        Promoter
ybjP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1008 903017 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1009 903019 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1010 903021 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1011 903080 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1012 903084 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1013 903161 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1014 903163 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1015 903465 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1016 903534 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1017 904477 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1019 904520 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1020 (cluster) 904522 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1021 (cluster) 904530 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB