RegulonDB RegulonDB 10.8: Gene Form
   

ybjT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybjT ybjS ltaE amiD anti-anti-terminator anti-terminator terminator ybjSp3 ybjSp3

Gene      
Name: ybjT    Texpresso search in the literature
Synonym(s): ECK0860, G6454, b0869
Genome position(nucleotides): 906852 <-- 908282 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.0
External database links:  
ASAP:
ABE-0002951
ECHOBASE:
EB3453
OU-MICROARRAY:
b0869
PortEco:
ybjT
STRING:
511145.b0869
COLOMBOS: ybjT


Product      
Name: putative NAD(P)-dependent oxidoreductase YbjT
Synonym(s): YbjT
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 53.707
Isoelectric point: 9.151
Motif(s):
 
Type Positions Sequence
440 -> 460 PHGMPGLFYWLLMIPAHLFIF
332 -> 463 VKTSASLAALWQVVNQIGGKERYFFGNILWQTRALMDRAIGHKLAKGRPEREYLQTGDAVDSWKVIVVEPEKQLTLLFGMKAPGLGRLCFSLEDKGDYRTIDVRAFWHPHGMPGLFYWLLMIPAHLFIFRGM
9 -> 152 GASGYIGQHLVRTLSQQGHQILAAARHVDRLAKLQLANVSCHKVDLSWPDNLPALLQDIDTVYFLVHSMGEGGDFIAQERQVALNVRDALREVPVKQLIFLSSLQAPPHEQSDHLRARQATADILREANVPVTELRAGIIVGAG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6454-MONOMER
ECOLIWIKI:
b0869
INTERPRO:
IPR021295
INTERPRO:
IPR036291
INTERPRO:
IPR016040
MODBASE:
P75822
PFAM:
PF11066
PFAM:
PF13460
PRIDE:
P75822
REFSEQ:
NP_415390
SMR:
P75822
UNIPROT:
P75822


Operon      
Name: hcp-hcr-poxB-ltaE-ybjT         
Operon arrangement:
Transcription unit        Promoter
ltaE-ybjT
poxB
hcp-hcr
hcp-hcr-poxB
hcp-hcr
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybjSp3 906898 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB