RegulonDB RegulonDB 10.8: Gene Form
   

hcr gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

poxB hcp hcr SoxS MarA TSS_1024 TSS_1024 hcrp3 hcrp3 poxBp poxBp

Gene      
Name: hcr    Texpresso search in the literature
Synonym(s): ECK0863, G6456, b0872, ybjV
Genome position(nucleotides): 911182 <-- 912150 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.42
External database links:  
ASAP:
ABE-0002960
ECHOBASE:
EB3455
OU-MICROARRAY:
b0872
PortEco:
hcr
STRING:
511145.b0872
COLOMBOS: hcr


Product      
Name: NADH oxidoreductase
Synonym(s): Hcr, YbjV
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 35.74
Isoelectric point: 5.436
Motif(s):
 
Type Positions Sequence
35 -> 104 YPYRAGQYALVSVRNSAETLRAYTISSTPGVSEYITLTVRRIDDGVGSQWLTRDVKRGDYLWLSDAMGEF
116 -> 210 LLAAGCGVTPIMSMRRWLAKNRPQADVRVIYNVRTPQDVIFADEWRNYPVTLVAENNVTEGFIAGRLTRELLAGVPDLASRTVMTCGPAPYMDWV
7 -> 107 QCPWRMQVHHITQETPDVWTISLICHDYYPYRAGQYALVSVRNSAETLRAYTISSTPGVSEYITLTVRRIDDGVGSQWLTRDVKRGDYLWLSDAMGEFTCD
237 -> 322 SGLKFTKLQPAREFYAPVGTTLLEALESNNVPVVAACRAGVCGCCKTKVVSGEYTVSSTMTLTDAEIAEGYVLACSCHPQGDLVLA
248 -> 315 REFYAPVGTTLLEALESNNVPVVAACRAGVCGCCKTKVVSGEYTVSSTMTLTDAEIAEGYVLACSCHP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016651 - oxidoreductase activity, acting on NAD(P)H
GO:0050660 - flavin adenine dinucleotide binding
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
biological_process GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6456-MONOMER
ECOLIWIKI:
b0872
INTERPRO:
IPR017938
INTERPRO:
IPR039261
INTERPRO:
IPR036010
INTERPRO:
IPR017927
INTERPRO:
IPR012675
INTERPRO:
IPR008333
INTERPRO:
IPR001433
INTERPRO:
IPR001041
INTERPRO:
IPR000951
MODBASE:
P75824
PFAM:
PF00970
PFAM:
PF00111
PFAM:
PF00175
PRIDE:
P75824
PRINTS:
PR00409
PRODB:
PRO_000022866
PROSITE:
PS51384
PROSITE:
PS51085
REFSEQ:
NP_415393
SMR:
P75824
UNIPROT:
P75824


Operon      
Name: hcp-hcr-poxB-ltaE-ybjT         
Operon arrangement:
Transcription unit        Promoter
ltaE-ybjT
poxB
hcp-hcr
hcp-hcr-poxB
hcp-hcr
 


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, OxyR, NarL, NarP
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hcrp3 912200 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1024 912408 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB