RegulonDB RegulonDB 10.8: Gene Form
   

macA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

macB macA ybjX cspD ybjD MqsA TSS_1028 (cluster) TSS_1028 (cluster) TSS_1027 TSS_1027 TSS_1026 TSS_1026 macBp2 macBp2 macBp1 macBp1 ybjXp ybjXp

Gene      
Name: macA    Texpresso search in the literature
Synonym(s): ECK0869, G6461, b0878, ybjY
Genome position(nucleotides): 919235 --> 920350 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.05
External database links:  
ASAP:
ABE-0002986
ECHOBASE:
EB3458
OU-MICROARRAY:
b0878
PortEco:
macA
STRING:
511145.b0878
COLOMBOS: macA


Product      
Name: ABC-type tripartite efflux pump membrane fusion protein
Synonym(s): MacA, YbjY, macrolide efflux pump - membrane fusion protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 40.624
Isoelectric point: 9.531
Motif(s):
 
Type Positions Sequence
49 -> 294 SVLATGKLDALRKVDVGAQVSGQLKTLSVAIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQRQQAEAELKLARVTYSRQQRLAQTKAVSQQDLDTAATEMAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAMLVKAQVSEADVIHLKPGQKAWFTVLGDPLTRYEGQIKDVLPTPEKVNDAIFYYARFEVPNPNGLLRLDMTA
11 -> 31 YVIALVIVIAGLITLWRILNA
357 -> 357 G
353 -> 353 G

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.8.A - Accessory Factors Involved in Transport
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:1990195 - macrolide transmembrane transporter complex
GO:1990196 - MacAB-TolC complex
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0019898 - extrinsic component of membrane
GO:0016021 - integral component of membrane
GO:1990281 - efflux pump complex
molecular_function GO:0042897 - polymyxin transmembrane transporter activity
GO:0005515 - protein binding
GO:0015562 - efflux transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
GO:0042802 - identical protein binding
GO:0001530 - lipopolysaccharide binding
biological_process GO:1990961 - xenobiotic detoxification by transmembrane export across the plasma membrane
GO:0042893 - polymyxin transport
GO:0046677 - response to antibiotic
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Pu Y., et al., 2016
[2] Tikhonova EB., et al., 2009
External database links:  
DIP:
DIP-11460N
ECOCYC:
MACA
ECOLIWIKI:
b0878
INTERPRO:
IPR032317
INTERPRO:
IPR030190
INTERPRO:
IPR006143
MODBASE:
P75830
PANTHER:
PTHR30469:SF34
PDB:
5NIK
PDB:
3FPP
PDB:
5NIL
PFAM:
PF16576
PRIDE:
P75830
PRODB:
PRO_000023144
REFSEQ:
NP_415399
SMR:
P75830
UNIPROT:
P75830


Operon      
Name: macAB         
Operon arrangement:
Transcription unit        Promoter
macAB
macB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter macBp1 920094 forward The sigma factor was determined
Read more >
[AIPP] [3]
  promoter macBp2 920337 forward The sigma factor was determined
Read more >
[AIPP] [3]
  promoter TSS_1026 921483 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1027 921911 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1028 (cluster) 922360 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]


Evidence    

 [AIPP] Automated inference of promoter position

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Pu Y., Zhao Z., Li Y., Zou J., Ma Q., Zhao Y., Ke Y., Zhu Y., Chen H., Baker MAB., Ge H., Sun Y., Xie XS., Bai F., 2016, Enhanced Efflux Activity Facilitates Drug Tolerance in Dormant Bacterial Cells., Mol Cell 62(2):284-294

 [2] Tikhonova EB., Dastidar V., Rybenkov VV., Zgurskaya HI., 2009, Kinetic control of TolC recruitment by multidrug efflux complexes., Proc Natl Acad Sci U S A 106(38):16416-21

 [3] Zhao K., Liu M., Burgess RR., 2005, The global transcriptional response of Escherichia coli to induced sigma 32 protein involves sigma 32 regulon activation followed by inactivation and degradation of sigma 32 in vivo., J Biol Chem 280(18):17758-68

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB