RegulonDB RegulonDB 10.8: Gene Form
   

ycaN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycaM ycaN ycaK ycaKp5 ycaKp5 ycaKp4 ycaKp4 ycaKp3 ycaKp3

Gene      
Name: ycaN    Texpresso search in the literature
Synonym(s): ECK0891, G6467, b0900
Genome position(nucleotides): 948660 <-- 949568 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.64
External database links:  
ASAP:
ABE-0003060
ECHOBASE:
EB3462
OU-MICROARRAY:
b0900
PortEco:
ycaN
STRING:
511145.b0900
COLOMBOS: ycaN


Product      
Name: putative LysR-type transcriptional regulator YcaN
Synonym(s): YcaN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.294
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
20 -> 40 FRAAGDELGLSSSAISHSIKT
91 -> 290 PTGTLKINAARVAARIFLMSLLVGFTREYPDIKVELTTDDSLVDIVQQGFDAGVRLSCIVEKDMISVAIGPPVKLCVAATPEYFARYGKPRHPHDLLNHQCVVFRYPSGKPFHWQFAKELEIAVAGNIILDDVDAELEAVLMGAGIGYLLYEQIKEYLDTGRLECVLEDWSTERPGFQIYYPNRQYMSCGLRAFLDYVKT
1 -> 60 MRMNMSDFATFFAVARNQSFRAAGDELGLSSSAISHSIKTLEQRLKIRLFNRTTRSVSLT
7 -> 63 DFATFFAVARNQSFRAAGDELGLSSSAISHSIKTLEQRLKIRLFNRTTRSVSLTEAG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2000
[2] Perez-Rueda E., et al., 2004
External database links:  
ECOCYC:
G6467-MONOMER
ECOLIWIKI:
b0900
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR005119
INTERPRO:
IPR000847
MODBASE:
P75836
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
P75836
PROSITE:
PS50931
REFSEQ:
NP_415420
SMR:
P75836
UNIPROT:
P75836


Operon      
Name: ycaN         
Operon arrangement:
Transcription unit        Promoter
ycaN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycaKp3 949547 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ycaKp4 949574 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ycaKp5 949643 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB