RegulonDB RegulonDB 10.8: Gene Form
   

ycaP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycaO serC ycaP CRP Lrp FNR anti-terminator anti-anti-terminator terminator TSS_1175 TSS_1175 TSS_1174 TSS_1174 TSS_1173 TSS_1173 TSS_1172 TSS_1172 serCp serCp TSS_1171 TSS_1171 serCp2 serCp2

Gene      
Name: ycaP    Texpresso search in the literature
Synonym(s): ECK0897, G6469, b0906
Genome position(nucleotides): 956762 --> 957454 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.62
External database links:  
ASAP:
ABE-0003089
ECHOBASE:
EB3464
OU-MICROARRAY:
b0906
PortEco:
ycaP
STRING:
511145.b0906
COLOMBOS: ycaP


Product      
Name: DUF421 domain-containing protein YcaP
Synonym(s): YcaP
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 26.282
Isoelectric point: 6.275
Motif(s):
 
Type Positions Sequence
104 -> 169 LLEGKPVVIIEDGELAWSKLNNSNMTEFEFFMELRLRGVEQLGQVRLAILETNGQISVYFFEDDKV
75 -> 95 VPVLIVFITLALLYRLVMWLM
16 -> 36 FDFLGEVALRSLYTFVLVFLF
48 -> 68 MSLFEVLIILTLGSAAGDVAF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11471N
ECOCYC:
G6469-MONOMER
ECOLIWIKI:
b0906
INTERPRO:
IPR007353
INTERPRO:
IPR023090
PFAM:
PF04239
PRIDE:
P75839
REFSEQ:
NP_415426
SMR:
P75839
UNIPROT:
P75839


Operon      
Name: ycaP         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1171 957585 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1172 957945 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1173 958104 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1174 958585 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1175 958602 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB