RegulonDB RegulonDB 10.8: Gene Form
   

ycaQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycaQ lpxK ycaR msbA kdsB TSS_1191 (cluster) TSS_1191 (cluster) ycaRp ycaRp TSS_1190 TSS_1190

Gene      
Name: ycaQ    Texpresso search in the literature
Synonym(s): ECK0907, G6471, b0916
Genome position(nucleotides): 969389 --> 970621 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.31
External database links:  
ASAP:
ABE-0003117
ECHOBASE:
EB3465
OU-MICROARRAY:
b0916
PortEco:
ycaQ
STRING:
511145.b0916
COLOMBOS: ycaQ


Product      
Name: winged helix DNA-binding domain-containing protein YcaQ
Synonym(s): YcaQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 47.656
Isoelectric point: 8.682
Motif(s):
 
Type Positions Sequence
38 -> 381 ISRMSLLQIDTINIVARSPYLVLFSRLGNYPAQWLDESLARGELMEYWAHEACFMPRSDFRLIRHRMLAPEKMGWKYKDAWMQEHEAEIAQLIQHIHDKGPVRSADFEHPRKGASGWWEWKPHKRHLEGLFTAGKVMVIERRNFQRVYDLTHRVMPDWDDERDLVSQTEAEIIMLDNSARSLGIFREQWLADYYRLKRPALAAWREARAEQQQIIAVHVEKLGNLWLHDDLLPLLERALAGKLTATHSAVLSPFDPVVWDRKRAEQLFDFSYRLECYTPAPKRQYGYFVLPLLHRGQLVGRMDAKMHRQTGILEVISLWLQEGIKPTTTLQKGLRQAITDFANW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6471-MONOMER
ECOLIWIKI:
b0916
INTERPRO:
IPR009351
PFAM:
PF06224
PRIDE:
P75843
REFSEQ:
NP_415436
SMR:
P75843
UNIPROT:
P75843


Operon      
Name: ycaI-msbA-lpxK-ycaQ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1190 970640 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1191 (cluster) 970643 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB