RegulonDB RegulonDB 10.8: Gene Form
   

ycaR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycaQ ycbJ kdsB ycaR elyC terminator anti-terminator anti-anti-terminator TSS_1193 TSS_1193 TSS_1192 TSS_1192 ycbJp ycbJp TSS_1191 (cluster) TSS_1191 (cluster) ycaRp ycaRp TSS_1190 TSS_1190

Gene      
Name: ycaR    Texpresso search in the literature
Synonym(s): ECK0908, G6472, b0917
Genome position(nucleotides): 970673 --> 970855 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.09
External database links:  
ASAP:
ABE-0003120
ECHOBASE:
EB4035
OU-MICROARRAY:
b0917
PortEco:
ycaR
STRING:
511145.b0917
COLOMBOS: ycaR


Product      
Name: UPF0434 family protein YcaR
Synonym(s): YcaR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 6.855
Isoelectric point: 4.647
Motif(s):
 
Type Positions Sequence
2 -> 41 DHRLLEIIACPVCNGKLWYNQEKQELICKLDNLAFPLRDG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6472-MONOMER
ECOLIWIKI:
b0917
INTERPRO:
IPR005651
PANTHER:
PTHR33505
PFAM:
PF03966
PRIDE:
P0AAZ7
REFSEQ:
NP_415437
SMR:
P0AAZ7
UNIPROT:
P0AAZ7


Operon      
Name: ycaR-kdsB         
Operon arrangement:
Transcription unit        Promoter
ycaR-kdsB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1190 970640 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1191 (cluster) 970643 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1192 971727 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1193 971733 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB