RegulonDB RegulonDB 10.8: Gene Form
   

ssuD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ssuD ssuA ssuC ssuE ssuB ssuBp3 ssuBp3

Gene      
Name: ssuD    Texpresso search in the literature
Synonym(s): ECK0926, G6477, b0935, ssi6, ycbN
Genome position(nucleotides): 994843 <-- 995988 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.98
External database links:  
ASAP:
ABE-0003178
ECHOBASE:
EB3470
OU-MICROARRAY:
b0935
PortEco:
ssuD
STRING:
511145.b0935
COLOMBOS: ssuD


Product      
Name: FMNH2-dependent alkanesulfonate monooxygenase
Synonym(s): SsuD, YcbN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.736
Isoelectric point: 5.97
Motif(s):
 
Type Positions Sequence
19 -> 19 G
298 -> 298 R
2 -> 381 SLNMFWFLPTHGDGHYLGTEEGSRPVDHGYLQQIAQAADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDRLSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLQRETVDFNGKHIHVRGAKLLFPAIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVRAKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFARTDSVGQQRMAALHNGKRDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGIDSFVLSGYPHLEEAYRVGELLFPLLDVAIPEIPQPQPLNPQGEAVANDFIPRKVAQS
5 -> 326 MFWFLPTHGDGHYLGTEEGSRPVDHGYLQQIAQAADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDRLSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLQRETVDFNGKHIHVRGAKLLFPAIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVRAKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFARTDSVGQQRMAALHNGKRDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGIDS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:1990201 - alkanesulfonate monooxygenase complex
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0004497 - monooxygenase activity
GO:0008726 - alkanesulfonate monooxygenase activity
GO:0016705 - oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0042802 - identical protein binding
biological_process GO:0009408 - response to heat
GO:0046306 - alkanesulfonate catabolic process
GO:0055114 - oxidation-reduction process
GO:0051289 - protein homotetramerization
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10928N
ECOCYC:
MONOMER-162
ECOLIWIKI:
b0935
INTERPRO:
IPR019911
INTERPRO:
IPR036661
INTERPRO:
IPR011251
MODBASE:
P80645
PDB:
1M41
PDB:
1NQK
PFAM:
PF00296
PRIDE:
P80645
PRODB:
PRO_000023996
REFSEQ:
NP_415455
SMR:
P80645
UNIPROT:
P80645


Operon      
Name: ssuEADCB         
Operon arrangement:
Transcription unit        Promoter
ssuEADCB


Transcriptional Regulation      
Display Regulation             
Activated by: Cbl, FNR, IHF
Repressed by: CysB, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ssuBp3 994141 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB