RegulonDB RegulonDB 10.7: Gene Form
   

ssuE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ssuD ssuA ssuE elfA IHF IHF Cbl CysB IHF anti-terminator anti-anti-terminator elfDp1 elfDp1 elfAp8 elfAp8 elfAp7 elfAp7 elfAp6 elfAp6 ssuEp ssuEp

Gene      
Name: ssuE    Texpresso search in the literature
Synonym(s): ECK0928, G6479, b0937, ssi4, ycbP
Genome position(nucleotides): 996937 <-- 997512 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.17
External database links:  
ASAP:
ABE-0003182
ECHOBASE:
EB3472
OU-MICROARRAY:
b0937
PORTECO:
ssuE
REGULONDB:
b0937
STRING:
511145.b0937
M3D: ssuE
COLOMBOS: ssuE
PortEco: b0937


Product      
Name: NADPH-dependent FMN reductase
Synonym(s): SsuE, YcbP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.253
Isoelectric point: 6.898
Motif(s):
 
Type Positions Sequence
1 -> 140 MRVITLAGSPRFPSRSSSLLEYAREKLNGLDVEVYHWNLQNFAPEDLLYARFDSPALKTFTEQLQQADGLIVATPVYKAAYSGALKTLLDLLPERALQGKVVLPLATGGTVAHLLAVDYALKPVLSALKAQEILHGVFAD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
Gene Ontology Terms (GO)  
cellular_component GO:1990202 - FMN reductase complex
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0008752 - FMN reductase activity
GO:0042803 - protein homodimerization activity
GO:0052873 - FMN reductase (NADPH) activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0009970 - cellular response to sulfate starvation
GO:0046306 - alkanesulfonate catabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10929N
ECOCYC:
MONOMER0-146
ECOLIWIKI:
b0937
INTERPRO:
IPR029039
INTERPRO:
IPR020048
INTERPRO:
IPR005025
MODBASE:
P80644
PDB:
6DQP
PDB:
6DQO
PDB:
6DQI
PDB:
4PU0
PDB:
4PTZ
PDB:
4PTY
PFAM:
PF03358
PRIDE:
P80644
PRODB:
PRO_000023997
PROTEINMODELPORTAL:
P80644
REFSEQ:
NP_415457
SMR:
P80644
UNIPROT:
P80644


Operon      
Name: ssuEADCB         
Operon arrangement:
Transcription unit        Promoter
ssuEADCB


Transcriptional Regulation      
Display Regulation             
Activated by: Cbl, FNR, IHF
Repressed by: CysB, IHF


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter elfAp6 997765 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter elfAp7 997808 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter elfAp8 997814 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter elfDp1 998321 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB