RegulonDB RegulonDB 10.8: Gene Form
   

elfA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

elfD ssuE elfA ssuA IHF IHF Cbl CysB IHF terminator anti-terminator anti-anti-terminator elfDp1 elfDp1 elfAp8 elfAp8 elfAp7 elfAp7 elfAp6 elfAp6 ssuEp ssuEp

Gene      
Name: elfA    Texpresso search in the literature
Synonym(s): ECK0929, G6480, b0938, ycbQ
Genome position(nucleotides): 997868 --> 998407 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.41
External database links:  
ASAP:
ABE-0003185
ECHOBASE:
EB3473
OU-MICROARRAY:
b0938
PortEco:
ycbQ
STRING:
511145.b0938
COLOMBOS: elfA


Product      
Name: putative laminin-binding fimbrial subunit
Synonym(s): ElfA, YcbQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 18.68
Isoelectric point: 4.101
Motif(s):
 
Type Positions Sequence
33 -> 178 TFNGKVIAPACTLVAATKDSVVTLPDVSATKLQTNGQVSGVQIDVPIELKDCDTTVTKNATFTFNGTADTTQITAFANQASSDAATNVALQMYMNDGTTAITPDTETGNILLQDGDQTLTFKVDYIATGKATSGNVNAVTNFHINY
1 -> 21 MKKSVLTAFITVVCATSSVMA
22 -> 179 ADDNAITDGSVTFNGKVIAPACTLVAATKDSVVTLPDVSATKLQTNGQVSGVQIDVPIELKDCDTTVTKNATFTFNGTADTTQITAFANQASSDAATNVALQMYMNDGTTAITPDTETGNILLQDGDQTLTFKVDYIATGKATSGNVNAVTNFHINYY

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [APPINH] Assay of protein partially-purified from its native host
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
G6480-MONOMER
ECOLIWIKI:
b0938
INTERPRO:
IPR008966
INTERPRO:
IPR036937
INTERPRO:
IPR000259
MODBASE:
P75855
PFAM:
PF00419
PRIDE:
P75855
REFSEQ:
NP_415458
SMR:
P75855
UNIPROT:
P75855


Operon      
Name: elfA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter elfAp6 997765 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter elfAp7 997808 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter elfAp8 997814 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter elfDp1 998321 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB