RegulonDB RegulonDB 10.7: Gene Form
   

ycbV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pyrD ycbF ycbU ycbV Fis PurR Cis-reg; leader anti-terminator pyrDp pyrDp

Gene      
Name: ycbV    Texpresso search in the literature
Synonym(s): ECK0934, G6485, b0943
Genome position(nucleotides): 1003439 --> 1003954 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.29
External database links:  
ASAP:
ABE-0003195
ECHOBASE:
EB3478
OU-MICROARRAY:
b0943
PORTECO:
ycbV
REGULONDB:
b0943
STRING:
511145.b0943
M3D: ycbV
COLOMBOS: ycbV
PortEco: b0943


Product      
Name: putative fimbrial protein YcbV
Synonym(s): YcbV
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 18.512
Isoelectric point: 5.105
Motif(s):
 
Type Positions Sequence
1 -> 17 MLKRIIWILFLLGLTWG
28 -> 170 NISGSFRRNTCVLAQDSKQINVQLGDVSLTRFSHGNYGPEKSFIINLQDCGTDVSTVDVTFSGTPDGVQSEMLSIESGTDAASGLAIAILDDAKILIPLNQASKDYSLHSGKVPLTFYAQLRPVNSDVQSGKVNASATFVLHY
18 -> 171 CELFAHDGTVNISGSFRRNTCVLAQDSKQINVQLGDVSLTRFSHGNYGPEKSFIINLQDCGTDVSTVDVTFSGTPDGVQSEMLSIESGTDAASGLAIAILDDAKILIPLNQASKDYSLHSGKVPLTFYAQLRPVNSDVQSGKVNASATFVLHYD

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Wurpel DJ., et al., 2013
External database links:  
DIP:
DIP-48182N
ECOCYC:
G6485-MONOMER
ECOLIWIKI:
b0943
INTERPRO:
IPR008966
INTERPRO:
IPR000259
INTERPRO:
IPR036937
MODBASE:
P75860
PFAM:
PF00419
PRIDE:
P75860
PROTEINMODELPORTAL:
P75860
REFSEQ:
NP_415463
SMR:
P75860
UNIPROT:
P75860


Operon      
Name: elfDCG-ycbUVF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835


RegulonDB