RegulonDB RegulonDB 10.8: Gene Form
   

rlmL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlmL uup ycbX zapC SoxS MarA terminator pqiAp1 pqiAp1 pqiAp2 pqiAp2 TSS_1248 TSS_1248 rlmLp rlmLp

Gene      
Name: rlmL    Texpresso search in the literature
Synonym(s): ECK0939, G6488, b0948, rlmK, rlmKL, ycbY
Genome position(nucleotides): 1007844 --> 1009952 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.24
External database links:  
ASAP:
ABE-0003211
ECHOBASE:
EB3481
OU-MICROARRAY:
b0948
PortEco:
rlmL
STRING:
511145.b0948
COLOMBOS: rlmL


Product      
Name: fused 23S rRNA m2G2445 methyltransferase and 23S rRNA m7G2069 methyltransferase
Synonym(s): RlmK, RlmKL, RlmL, YcbY, ribosomal RNA large subunit methyltransferase L
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 78.854
Isoelectric point: 9.107
Motif(s):
 
Type Positions Sequence
597 -> 597 D
398 -> 702 RLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYADWVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLKTRERQKGKNQYQKLGEKGEFLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGKDFLNLFSYTGSATVHAGLGGARSTTTVDMSRTYLEWAERNLRLNGLTGRAHRLIQADCLAWLREANEQFDLIFIDPPTFSNSKRMEDAFDVQRDHLALMKDLKRLLRAGGTIMFSNNKRGFRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCWLITAA
43 -> 154 LVYQSLMWSRLASRIMLPLGECKVYSDLDLYLGVQAINWTEMFNPGATFAVHFSGLNDTIRNSQYGAMKVKDAIVDAFTRKNLPRPNVDRDAPDIRVNVWLHKETASIALDL
397 -> 397 N
1 -> 397 MNSLFASTARGLEELLKTELENLGAVECQVVQGGVHFKGDTRLVYQSLMWSRLASRIMLPLGECKVYSDLDLYLGVQAINWTEMFNPGATFAVHFSGLNDTIRNSQYGAMKVKDAIVDAFTRKNLPRPNVDRDAPDIRVNVWLHKETASIALDLSGDGLHLRGYRDRAGIAPIKETLAAAIVMRSGWQPGTPLLDPMCGSGTLLIEAAMLATDRAPGLHRGRWGFSGWAQHDEAIWQEVKAEAQTRARKGLAEYSSHFYGSDSDARVIQRARTNARLAGIGELITFEVKDVAQLTNPLPKGPYGTVLSNPPYGERLDSEPALIALHSLLGRIMKNQFGGWNLSLFSASPDLLSCLQLRADKQYKAKNGPLDCVQKNYHVAESTPDSKPAMVAEDYTN

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0003676 - nucleic acid binding
GO:0005515 - protein binding
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0003723 - RNA binding
GO:0008990 - rRNA (guanine-N2-)-methyltransferase activity
GO:0070043 - rRNA (guanine-N7-)-methyltransferase activity
GO:0052915 - 23S rRNA (guanine(2445)-N(2))-methyltransferase activity
biological_process GO:0031167 - rRNA methylation
GO:0006364 - rRNA processing
GO:0032259 - methylation
GO:0070475 - rRNA base methylation
GO:0070476 - rRNA (guanine-N7)-methylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11486N
ECOCYC:
G6488-MONOMER
ECOLIWIKI:
b0948
INTERPRO:
IPR017244
INTERPRO:
IPR029063
INTERPRO:
IPR019614
INTERPRO:
IPR004114
INTERPRO:
IPR002052
INTERPRO:
IPR000241
MINT:
MINT-1268879
MODBASE:
P75864
PDB:
3V8V
PDB:
3V97
PFAM:
PF01170
PFAM:
PF10672
PFAM:
PF02926
PRIDE:
P75864
PRINTS:
PR00507
PRODB:
PRO_000023772
PROSITE:
PS51165
PROSITE:
PS01261
REFSEQ:
NP_415468
SMART:
SM00981
SMR:
P75864
UNIPROT:
P75864


Operon      
Name: rlmL-uup         
Operon arrangement:
Transcription unit        Promoter
rlmL-uup


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1248 1008970 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB