RegulonDB RegulonDB 10.8: Gene Form
   

uup gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlmL uup pqiA SoxS MarA pqiAp1 pqiAp1 pqiAp2 pqiAp2 TSS_1248 TSS_1248

Gene      
Name: uup    Texpresso search in the literature
Synonym(s): ECK0940, G6489, b0949, ycbH, ycbI
Genome position(nucleotides): 1009964 --> 1011871 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.41
External database links:  
ASAP:
ABE-0003213
ECHOBASE:
EB2933
OU-MICROARRAY:
b0949
PortEco:
uup
STRING:
511145.b0949
COLOMBOS: uup


Product      
Name: ATP-binding protein Uup
Synonym(s): ATP-binding protein with possible role in replication, Uup, YcbH, YcbI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 72.067
Isoelectric point: 5.181
Motif(s):
 
Type Positions Sequence
320 -> 546 FEMEDVCYQVNGKQLVKDFSAQVLRGDKIALIGPNGCGKTTLLKLMLGQLQADSGRIHVGTKLEVAYFDQHRAELDPDKTVMDNLAEGKQEVMVNGKPRHVLGYLQDFLFHPKRAMTPVRALSGGERNRLLLARLFLKPSNLLILDEPTNDLDVETLELLEELIDSYQGTVLLVSHDRQFVDNTVTECWIFEGGGKIGRYVGGYHDARGQQEQYVALKQPAVKKTEE
19 -> 185 LDNAELHIEDNERVCLVGRNGAGKSTLMKILNREQGLDDGRIIYEQDLIVARLQQDPPRNVEGSVYDFVAEGIEEQAEYLKRYHDISRLVMNDPSEKNLNELAKVQEQLDHHNLWQLENRINEVLAQLGLDPNVALSSLSGGWLRKAALGRALVSNPRVLLLDEPTN
36 -> 43 GRNGAGKS
1 -> 253 MSLISMHGAWLSFSDAPLLDNAELHIEDNERVCLVGRNGAGKSTLMKILNREQGLDDGRIIYEQDLIVARLQQDPPRNVEGSVYDFVAEGIEEQAEYLKRYHDISRLVMNDPSEKNLNELAKVQEQLDHHNLWQLENRINEVLAQLGLDPNVALSSLSGGWLRKAALGRALVSNPRVLLLDEPTNHLDIETIDWLEGFLKTFNGTIIFISHDRSFIRNMATRIVDLDRGKLVTYPGNYDQYLLEKEEALRVEE
224 -> 293 VDLDRGKLVTYPGNYDQYLLEKEEALRVEELQNAEFDRKLAQEEVWIRQGIKARRTRNEGRVRALKAMRR

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005886 - plasma membrane
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0042255 - ribosome assembly
GO:0009314 - response to radiation
GO:0006301 - postreplication repair
GO:0070894 - regulation of transposon integration
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IMP] Inferred from mutant phenotype
Reference(s): [1] Lovett ST. 2017
[2] Murat D., et al., 2006
[3] Reddy M., et al., 1997
External database links:  
DIP:
DIP-11099N
ECOCYC:
UUP-MONOMER
ECOLIWIKI:
b0949
INTERPRO:
IPR003439
INTERPRO:
IPR037118
INTERPRO:
IPR032781
INTERPRO:
IPR032524
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003593
MINT:
MINT-1228036
MODBASE:
P43672
PDB:
2LW1
PFAM:
PF12848
PFAM:
PF00005
PFAM:
PF16326
PRIDE:
P43672
PRODB:
PRO_000024197
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_415469
SMART:
SM00382
SMR:
P43672
UNIPROT:
P43672


Operon      
Name: rlmL-uup         
Operon arrangement:
Transcription unit        Promoter
rlmL-uup


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1248 1008970 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lovett ST., 2017, Template-switching during replication fork repair in bacteria., DNA Repair (Amst) 56:118-128

 [2] Murat D., Bance P., Callebaut I., Dassa E., 2006, ATP hydrolysis is essential for the function of the Uup ATP-binding cassette ATPase in precise excision of transposons., J Biol Chem 281(10):6850-9

 [3] Reddy M., Gowrishankar J., 1997, A genetic strategy to demonstrate the occurrence of spontaneous mutations in nondividing cells within colonies of Escherichia coli., Genetics 147(3):991-1001

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB