RegulonDB RegulonDB 10.8: Gene Form
   

pqiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uup pqiB pqiA pqiC SoxS MarA pqiAp1 pqiAp1 pqiAp2 pqiAp2

Gene      
Name: pqiA    Texpresso search in the literature
Synonym(s): ECK0941, G6490, b0950, pqi5, pqi5A
Genome position(nucleotides): 1012001 --> 1013254 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.23
External database links:  
ASAP:
ABE-0003219
ECHOBASE:
EB2794
OU-MICROARRAY:
b0950
PortEco:
pqiA
STRING:
511145.b0950
COLOMBOS: pqiA


Product      
Name: intermembrane transport protein PqiA
Synonym(s): PqiA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 46.464
Isoelectric point: 7.907
Motif(s):
 
Type Positions Sequence
49 -> 200 QRPTAYALAALFMLLLSNLFPFVNMNVAGVTSEITLLEIPGVLFSEDYASLGTFFLLFVQLVPAFCLITILLLVNRAELPVRLKEQLARVLFQLKTWGMAEIFLAGVLVSFVKLMAYGSIGVGSSFLPWCLFCVLQLRAFQCVDRRWLWDDI
257 -> 277 LALLVTSIMLYLPANILPIMV
371 -> 391 MGGLMSIYPAMGALMFALVVI
102 -> 122 FFLLFVQLVPAFCLITILLLV
51 -> 71 PTAYALAALFMLLLSNLFPFV

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0120009 - intermembrane lipid transfer
GO:0006950 - response to stress
GO:0061024 - membrane organization
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
[IGI] Inferred from genetic interaction
Reference(s): [1] Ekiert DC., et al., 2017
[2] Koh YS., et al., 1995
[3] Nakayama T., et al., 2017
External database links:  
ECOCYC:
G6490-MONOMER
ECOLIWIKI:
b0950
INTERPRO:
IPR007498
INTERPRO:
IPR005219
PFAM:
PF04403
PRIDE:
P0AFL9
PRODB:
PRO_000023585
REFSEQ:
NP_415470
UNIPROT:
P0AFL9


Operon      
Name: pqiABC         
Operon arrangement:
Transcription unit        Promoter
pqiABC
pqiABC
ymbA


Transcriptional Regulation      
Display Regulation             
Activated by: MarA, SoxS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Ekiert DC., Bhabha G., Isom GL., Greenan G., Ovchinnikov S., Henderson IR., Cox JS., Vale RD., 2017, Architectures of Lipid Transport Systems for the Bacterial Outer Membrane., Cell 169(2):273-285.e17

 [2] Koh YS., Roe JH., 1995, Isolation of a novel paraquat-inducible (pqi) gene regulated by the soxRS locus in Escherichia coli., J Bacteriol 177(10):2673-8

 [3] Nakayama T., Zhang-Akiyama QM., 2017, pqiABC and yebST, Putative mce Operons of Escherichia coli, Encode Transport Pathways and Contribute to Membrane Integrity., J Bacteriol 199(1)


RegulonDB