RegulonDB RegulonDB 10.8: Gene Form
   

pqiB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pqiB pqiA pqiC rmf CRP ppGpp terminator anti-terminator rmfp rmfp rmfp4 rmfp4 rmfp5 rmfp5

Gene      
Name: pqiB    Texpresso search in the literature
Synonym(s): ECK0942, G6491, b0951, pqi5, pqi5B
Genome position(nucleotides): 1013259 --> 1014899 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.21
External database links:  
ASAP:
ABE-0003221
ECHOBASE:
EB2795
OU-MICROARRAY:
b0951
PortEco:
pqiB
STRING:
511145.b0951
COLOMBOS: pqiB


Product      
Name: intermembrane transport protein PqiB
Synonym(s): PqiB
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 60.52
Isoelectric point: 8.536
Motif(s):
 
Type Positions Sequence
16 -> 36 WSPVWIFPIVTALIGAWVLFY
285 -> 389 HIDYLMFFKDSVRGLQPGAPVEFRGIRLGTVSKVPFFAPNMRQTFNDDYRIPVLIRIEPERLKMQLGENADVVEHLGELLKRGLRGSLKTGNLVTGALYVDLDFY
158 -> 217 IRVILDSKKAGQLSPGDPVLFRGYRVGSVETSTFDTQKRNISYQLFINAPYDRLVTNNVR
42 -> 133 GPEVTLITANAEGIEGGKTTIKSRSVDVGVVESATLADDLTHVEIKARLNSGMEKLLHKDTVFWVVKPQIGREGISGLGTLLSGVYIELQPG

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0120009 - intermembrane lipid transfer
GO:0061024 - membrane organization
External database links:  
DIP:
DIP-10555N
ECOCYC:
G6491-MONOMER
ECOLIWIKI:
b0951
INTERPRO:
IPR003399
MINT:
MINT-1310231
PDB:
5UVN
PFAM:
PF02470
PRIDE:
P43671
PRODB:
PRO_000023586
REFSEQ:
NP_415471
SMR:
P43671
UNIPROT:
P43671


Operon      
Name: pqiABC         
Operon arrangement:
Transcription unit        Promoter
pqiABC
pqiABC
ymbA


Transcriptional Regulation      
Display Regulation             
Activated by: MarA, SoxS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rmfp5 1015503 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter rmfp4 1015532 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB