RegulonDB RegulonDB 10.8: Gene Form
   

hspQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlmI yccU hspQ terminator TSS_1294 (cluster) TSS_1294 (cluster) TSS_1293 TSS_1293

Gene      
Name: hspQ    Texpresso search in the literature
Synonym(s): ECK0957, G6500, b0966, yccV
Genome position(nucleotides): 1028404 <-- 1028721 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.66
External database links:  
ASAP:
ABE-0003269
ECHOBASE:
EB3488
OU-MICROARRAY:
b0966
PortEco:
hspQ
STRING:
511145.b0966
COLOMBOS: hspQ


Product      
Name: heat shock protein, hemimethylated DNA-binding protein
Synonym(s): HspQ, YccV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.779
Isoelectric point: 4.291
Motif(s):
 
Type Positions Sequence
5 -> 96 KFGIGQQVRHSLLGYLGVVVDIDPVYSLSEPSPDELAVNDELRAAPWYHVVMEDDNGLPVHTYLAEAQLSSELQDEHPEQPSMDELAQTIRK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related
  3 - regulation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0003677 - DNA binding
biological_process GO:0009408 - response to heat
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48155N
ECOCYC:
G6500-MONOMER
ECOLIWIKI:
b0966
INTERPRO:
IPR022866
INTERPRO:
IPR036623
INTERPRO:
IPR011722
PDB:
5YCQ
PFAM:
PF08755
PRIDE:
P0AB20
PRODB:
PRO_000022936
REFSEQ:
NP_415486
SMART:
SM00992
SMR:
P0AB20
UNIPROT:
P0AB20


Operon      
Name: hspQ         
Operon arrangement:
Transcription unit        Promoter
hspQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1293 1028531 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1294 (cluster) 1028744 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB